KEGG   Carnobacterium maltaromaticum: BN424_832Help
Entry
BN424_832         CDS       T02342                                 

Gene name
livF
Definition
(GenBank) ABC transporter family protein
  KO
K01996  branched-chain amino acid transport system ATP-binding protein
Organism
cml  Carnobacterium maltaromaticum
Pathway
cml02010  ABC transporters
cml02024  Quorum sensing
Module
cml_M00237  Branched-chain amino acid transport system
Brite
KEGG Orthology (KO) [BR:cml00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    BN424_832 (livF)
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    BN424_832 (livF)
Transporters [BR:cml02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Branched-chain amino acid transporter [MD:M00237] [OT]
    BN424_832 (livF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 AAA_29 AAA_23 AAA_15 SMC_N AAA_27 AAA_30 RsgA_GTPase BCA_ABC_TP_C G-alpha AAA_22 MukB AAA_16 MMR_HSR1 DUF2813 NB-ARC DUF2815 AAA_33
Motif
Other DBs
NCBI-ProteinID: CCO10296
UniProt: K8EP76
Position
892742..893446
Genome map
AA seq 234 aa AA seqDB search
MLKVKDLSVHYGVIQAINKINFEVHEGEIVSLIGANGAGKSTILKAISGLYRPSEGEILF
KDTPIQKASTKKIVESGISLVPEGRHVFSGMTVLENLELGAYLRKDKDGIKQDLENIYER
FPVLAERKKQDTATLSGGEQQMVAMGRAMMSRPKLLLLDEPSMGLAPIFIKEIFSIIKDI
NQQGTTVLLIEQNAKVALSISNRGYVLETGKVVLSGTGEELLASDEVQKAYLGG
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaagtaaaagacttatctgttcattatggtgtgattcaagccataaataaaata
aattttgaagttcatgaaggtgaaattgtttcgctaatcggtgcaaatggtgcgggaaaa
tcaacaatattaaaagcaatttcaggtttatatcgtcctagtgaaggggaaatccttttt
aaagatacgccgattcaaaaagcatccactaaaaaaattgtggaatccggcatctcttta
gttccagaagggcgccatgtttttagtggtatgacagttttagaaaatcttgaattaggt
gcctatctacgtaaagataaagatggaattaagcaagacctagaaaacatctatgaacgt
tttccagttttagcagaacggaaaaaacaagatacagcgacactttcaggcggagagcaa
caaatggttgcaatggggagagccatgatgtcaaggcctaaacttctattgcttgatgaa
ccctcaatggggctcgcacctatctttattaaagaaatttttagcattattaaagacatt
aatcagcaaggaacaacggttttattgattgaacaaaatgcgaaagtagcgctatctatt
tcaaatcgagggtatgttttagaaactggaaaagttgtactaagtggaactggcgaggaa
ttattagctagtgatgaagttcaaaaagcctatttaggaggataa

DBGET integrated database retrieval system