KEGG   Carnobacterium maltaromaticum: BN424_834Help
Entry
BN424_834         CDS       T02342                                 

Definition
(GenBank) putative uncharacterized protein
Organism
cml  Carnobacterium maltaromaticum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: WYL DUF2584 DUF1155
Motif
Other DBs
NCBI-ProteinID: CCO10298
UniProt: K8EES6
Position
complement(894153..894734)
Genome map
AA seq 193 aa AA seqDB search
MKKRLSFNGSPQHYPTFFLKELLLYSMNQNVVQISYQKKDLTLTKRWIQPLGLEAMDGKW
YCNAFDFEKNDYRIFRCDLILELTESKRYVAKDFADFDIRQNHLKKNKSQAATEFTVQLT
TFGVERFNQRHYPNMSLVEEKGDFYIQGWFEPHELNFMVDYLITFGDSAKIIAPQSLIAL
YKDKLKIMLSHYQ
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaaggctctcatttaatggttcacctcaacattatccaaccttttttctaaaa
gaattacttctttactcaatgaaccaaaatgttgttcaaattagctatcaaaaaaaagac
ttaacgctaactaagcgttggattcaacctttaggacttgaagcgatggatggaaaatgg
tattgtaacgcttttgattttgaaaaaaatgactatcgaatttttcgttgtgacttaatt
ctagaacttacagaatctaaacgatatgtagcaaaagattttgcggattttgatattcgc
caaaatcatttaaaaaagaataaaagccaagctgctactgaattcacagtacaactgact
acttttggagtagagcgttttaatcaacgacactatcctaatatgagtttagttgaggaa
aaaggtgatttttatatacaaggttggttcgaaccccatgagttaaactttatggtagac
tatttgattacttttggagattcagctaaaattattgctcctcaaagccttattgctctc
tataaagataaacttaaaataatgttatctcattatcaataa

DBGET integrated database retrieval system