KEGG   Carnobacterium maltaromaticum: BN424_841Help
Entry
BN424_841         CDS       T02342                                 

Definition
(GenBank) hypothetical protein
Organism
cml  Carnobacterium maltaromaticum
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: CCO10305
UniProt: K8E2P7
Position
899972..900088
Genome map
AA seq 38 aa AA seqDB search
MSQLFEKKIKIRDGKKRHINFSYFLARVKRLNKLFIKE
NT seq 117 nt NT seq  +upstreamnt  +downstreamnt
atgagccaactcttcgagaaaaagataaaaattcgagatggcaaaaagcgccatatcaat
ttttcctattttcttgccagagttaaacggctcaacaaactttttataaaggagtga

DBGET integrated database retrieval system