KEGG   Carnobacterium maltaromaticum: BN424_844Help
Entry
BN424_844         CDS       T02342                                 

Gene name
pbp3r
Definition
(GenBank) NTF2-like N-terminal transpeptidase domain protein
  KO
K21467  penicillin-binding protein 3
Organism
cml  Carnobacterium maltaromaticum
Brite
KEGG Orthology (KO) [BR:cml00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cml01011]
    BN424_844 (pbp3r)
Peptidoglycan biosynthesis and degradation proteins [BR:cml01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   BN424_844 (pbp3r)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer MecA_N
Motif
Other DBs
NCBI-ProteinID: CCO10308
UniProt: K8EET8
Position
901639..903669
Genome map
AA seq 676 aa AA seqDB search
MRQVKKEKNKTVLMIVASILLVIAMVGGTFYYKWNNSQKSDRAALETGKNFTKALEKQDF
KKLSQLVTSESLKKVDYTKESLVDKYTVIFDGINASKLKISDLSVTPIENKPEFKLTYTL
NMQTNLGKFDEEKYEAILVPNGENFLVEWTAQLIFPEMEATDKINITSTFGKRGSIVDRN
GNPLAYLAQYPEVGMIPGELGSGADKAANLKAISEQFDVSVESLENSLTAEWVKPNIFVP
IKVLPNGETPVMTGIQYASKDMRSYPLNQAAAHLIGYVGEVSAEDIEKDPNLNVGDTIGK
AGLEATFEKRLRGKNGGRIVMNDQDGNLKKVLQESEKTDGETISLTIDSKLQQQAFDQLN
GEKSSAVIMNPQDGSLLALVSTPSYDANLMATGISSKEYDAYANDPNLPFLVRYASGYAP
GSTFKAITAGIGLDAGVTKENKEREISGLKWQKNSSWGNYFVTRVSDVSPVNMDQALIYS
DNIYFAQEGLEMGKKTFEAGLNKFIFGEKFDLPLAMDPAQIANKKGLNTDILLADTAYGQ
GQLLLNPIQQAVSYSPFADDGMIMYPKLTADQKTAKSKQAITPESAAIVKNALIQVVDDP
NGTARTLAIQGHKIAAKTGTAELKQEQDTKGDENGFLLAIDADNASYLMVAMIEGKSSHV
VIEKMKPVLESIYAGQ
NT seq 2031 nt NT seq  +upstreamnt  +downstreamnt
ttgagacaagtaaaaaaggaaaaaaataaaacagtgctaatgattgttgcatctatttta
ttagtcattgcgatggttggcggtacgttttattataagtggaataatagtcaaaaaagt
gatcgagcagcgttggagacaggtaagaattttacaaaagcacttgaaaaacaagacttt
aaaaaacttagtcaattagttacttctgaatcattaaaaaaagttgattatacaaaagaa
tcattggttgataaatatacagttatatttgatggcattaatgcgagcaaattgaaaatt
agtgatttgtcagtcactccaattgaaaataaacctgaatttaaattaacgtatactcta
aatatgcagacgaatttaggtaaatttgatgaggaaaaatatgaagcaatcttagttcct
aatggtgaaaactttttagttgaatggactgctcagttaatctttcccgaaatggaagca
actgataaaataaatatcacttcaacatttggaaaaagaggttcaatagtcgatcgtaat
ggaaacccattagcttatttagcccaataccctgaagttggaatgattccaggtgaattg
ggttcaggagcagataaggccgcaaatttaaaggcaattagtgaacaatttgatgtttca
gttgaaagcttagaaaatagtttaacagcggaatgggtcaaacccaatatatttgtgcct
atcaaagttttaccaaatggtgaaactccggttatgacgggaatccaatatgcttctaaa
gatatgcgctcttacccgttaaatcaagcggctgcgcacttaattggatatgttggcgaa
gtttcagcagaagatattgagaaagatccgaacttaaatgtaggggatacaattggaaag
gctggtttagaagcaacttttgagaaacgtttacgtgggaaaaatggtgggcgaattgtg
atgaacgatcaagatggcaacttgaaaaaagttcttcaagaatctgaaaaaacagatgga
gaaacaatttctttaaccattgatagtaaattacaacaacaagcctttgatcaattaaat
ggtgaaaaatcttctgctgttattatgaaccctcaagatggcagcttgttagctttagtt
agtacgccatcctatgatgccaatttaatggctacaggaatttccagcaaagagtacgat
gcatatgccaatgatcctaatttaccattcttagtccgttatgcaagtggttatgcgcca
ggatcaacctttaaggcgattacggctggaatcggcttagatgcaggtgtgacgaaagaa
aataaagaacgagagatttctggtttgaaatggcaaaaaaatagttcttggggcaattat
tttgtcactcgagtctcagatgtatcaccagtaaatatggaccaagcactgatttattca
gacaatatctattttgcgcaagaagggctagaaatgggtaaaaagacctttgaagctggc
ttaaataagttcatctttggagaaaaatttgatttaccactagctatggacccagctcaa
attgccaataaaaaaggtctgaatacggatattttattagcggatacagcatatggtcag
ggacaattattattaaatccaattcaacaggctgtttcttattcaccatttgccgatgac
ggaatgattatgtatccgaaactaacagctgatcaaaaaacagcaaaaagtaaacaagcc
atcacacctgagtctgcagctattgtcaaaaacgctctgattcaagtagttgatgatcca
aatgggacagcacgaactttagcaattcaaggacacaaaattgctgctaaaacgggtaca
gcagaattaaaacaagaacaagatactaaaggcgatgaaaatggcttcttactagcaatt
gatgcagataatgctagctatttgatggtggccatgattgaaggtaaaagtagtcatgtt
gtcattgaaaaaatgaagccagttttagaaagtatttatgcgggtcaataa

DBGET integrated database retrieval system