KEGG   Carnobacterium maltaromaticum: BN424_852Help
Entry
BN424_852         CDS       T02342                                 

Gene name
purE
Definition
(GenBank) phosphoribosylaminoimidazole carboxylase,catalytic subunit
  KO
K01588  5-(carboxyamino)imidazole ribonucleotide mutase [EC:5.4.99.18]
Organism
cml  Carnobacterium maltaromaticum
Pathway
cml00230  Purine metabolism
cml01100  Metabolic pathways
cml01110  Biosynthesis of secondary metabolites
cml01130  Biosynthesis of antibiotics
Module
cml_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:cml00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BN424_852 (purE)
Enzymes [BR:cml01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.18  5-(carboxyamino)imidazole ribonucleotide mutase
     BN424_852 (purE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AIRC
Motif
Other DBs
NCBI-ProteinID: CCO10316
UniProt: K8EPA0
Position
909602..910090
Genome map
AA seq 162 aa AA seqDB search
MTEKVAVIMGSTSDWETMKFTCDILDEFGIAYQKKVVSAHRTPDYMFEFAKGARASGLQV
IIAGAGGAAHLPGMVAAQTTLPVIGVPIESAALKGMDSLLSIVQMPGGVPVATVAIGKAG
ATNAGLLALEMLSMTDGEIADKLDKRRIKLKEKVMESSDELV
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
ttgaccgaaaaagttgcagtgattatgggaagtacttcagattgggaaacaatgaaattt
acgtgtgacattttagatgaatttggtatcgcctatcaaaaaaaagttgtctctgctcat
cgaacaccagattatatgtttgaatttgcaaaaggtgctagagcaagtgggcttcaagtc
attattgcaggagctggtggtgccgctcacttgccaggaatggtcgctgcgcaaacaaca
ttaccggttattggtgttccaattgaatctgctgcattaaaagggatggattctctattg
tcgattgttcaaatgccaggaggagttccagtagctactgttgcgattggaaaagcagga
gcaacgaatgcaggtttgttggctttagaaatgttatcaatgacagatggggaaattgct
gataaactagataagagaagaataaagcttaaagaaaaagtaatggaaagtagtgatgaa
cttgtctaa

DBGET integrated database retrieval system