KEGG   Carnobacterium maltaromaticum: BN424_854Help
Entry
BN424_854         CDS       T02342                                 

Gene name
purB
Definition
(GenBank) adenylosuccinate lyase
  KO
K01756  adenylosuccinate lyase [EC:4.3.2.2]
Organism
cml  Carnobacterium maltaromaticum
Pathway
cml00230  Purine metabolism
cml00250  Alanine, aspartate and glutamate metabolism
cml01100  Metabolic pathways
cml01110  Biosynthesis of secondary metabolites
cml01130  Biosynthesis of antibiotics
Module
cml_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
cml_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:cml00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    BN424_854 (purB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BN424_854 (purB)
Enzymes [BR:cml01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.2  Amidine-lyases
    4.3.2.2  adenylosuccinate lyase
     BN424_854 (purB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lyase_1 ADSL_C
Motif
Other DBs
NCBI-ProteinID: CCO10318
UniProt: K8EEU9
Position
911218..912516
Genome map
AA seq 432 aa AA seqDB search
MIERYTRPEMGAIWTDENRYDTWLEVEILADEAWAELGEIPKEDAQKIRENASFDVARIL
EIEAETRHDVVAFTRAVSESLGAERKWVHYGLTSTDVVDTAYGYQLKQANDILRQDLQRF
LEIIGTKAKEHKMTVMMGRTHGVHAEPTTFGLKLALWYSEMKRNIERFEHAAKGVEAGKI
SGAVGTFANIPPFVEEYVCEKLEIRPQEISTQVLPRDLHAEYVSAMALIATSIEKFATEI
RGLQKSETREVEEFFAKGQKGSSAMPHKRNPIGSENMSGLARVIRGYMVTAYENVTLWHE
RDISHSSAERIILPDTTILLNYMLNRFGNIVKNLTVFPENMLRNMDATFGLIYSQRVLLK
LIDNGMSREAAYDLVQPKTAISWDEQVQFRPLLEADPEVTAILSQADLDDAFDYHHHLKN
VDVIFERVGLGE
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgattgaacgttatacaagacctgagatgggtgcaatttggacagatgaaaaccgctat
gatacatggctggaagtagagattttagccgatgaagcttgggctgagcttggtgaaata
cctaaagaagatgctcaaaaaattagagaaaatgcttcttttgatgttgcacgtatttta
gaaattgaggcagaaacacgtcatgatgttgtagcctttacacgtgctgtttcggaatct
ttaggtgcagaacgtaaatgggtgcattatggtttaactagtacggacgtagttgataca
gcttatggctatcaattaaagcaagccaatgatatcttacgtcaagacttacaaagattt
ttagaaatcattggaactaaagcgaaagaacacaaaatgacggttatgatgggaagaact
cacggagttcatgctgaaccaacaacattcggcctaaagttagcgttatggtattcagaa
atgaaacggaatattgaacgctttgaacatgctgctaaaggtgttgaagctgggaaaata
agtggagctgtaggaacatttgcgaatattcctccatttgttgaagaatatgtttgtgaa
aaattagaaattcgcccgcaagaaatttcaacgcaagttttaccaagagatttgcatgct
gagtacgtttcagcaatggcactgattgcgacaagtatcgaaaaatttgctaccgagatt
cgtggcttacaaaagtctgaaacacgagaagtagaagaattttttgcgaaaggtcaaaaa
ggttcatctgcaatgccgcataaacgtaatccaatcggctctgaaaacatgtctggttta
gctcgtgttattcgtggctacatggtaactgcttatgaaaatgtgacattatggcatgaa
cgcgatatttcccattcatcagcggaacgaattattttacctgatacaacgattttatta
aattatatgttaaatcgttttggaaatattgttaaaaatctgacggtcttcccagaaaat
atgttacgtaatatggatgctacttttggattgatttatagccagcgtgttttattaaaa
ctaattgataatggaatgagccgtgaagctgcttatgatttagttcaacctaaaacagct
atttcatgggatgaacaagtccaattccgcccattattagaagctgatccagaagttaca
gctattttaagccaagcagatttagatgacgcttttgattatcatcatcatttaaagaac
gttgatgttatttttgaacgtgtaggcttaggtgaatag

DBGET integrated database retrieval system