KEGG   Carnobacterium maltaromaticum: BN424_856Help
Entry
BN424_856         CDS       T02342                                 

Definition
(GenBank) sigma-54 interaction domain protein
Organism
cml  Carnobacterium maltaromaticum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sigma54_activat Sigma54_activ_2 Mg_chelatase AAA_5 HTH_8 Roc AAA_19 AAA RsgA_GTPase AAA_16 PAS_9 MCM PAS AAA_3
Motif
Other DBs
NCBI-ProteinID: CCO10320
UniProt: K8E2Q7
Position
914248..915609
Genome map
AA seq 453 aa AA seqDB search
MTKTVTKLMNDDVTTLFVTDGEGNILLANEFTAMTLGMPLNTLLNSNVYDLVASNIYNAS
ATIETLKTHKMSEVNLTTKAGYQIKSKSTPIFYPDKTLHLVVTKSDPLTIEELERWTKNI
AETSKETEEFSELEVNEKVIAESNEMKRVLRVCKQVSKYNSRILLLGESGVGKEVVANYI
HQHSQLADCQFITVNCAAIPDNLFESEFFGYKKGTFTGAKEDKIGLIEAADGGTLFLDEI
SEMPLEMQTKLLRALETMKIRKVGDIAEIPISFRLISASNQDILSLVEKGKFRRDLYYRI
NAIPVVIPPLRERKKDVLALANYFIDYFNQQHQRSISLETQHIKHLMLSEWSGNVRELKN
YIEYLVVTADLDLPVHQGGYETPSNDQIEESLQAIAGECDYQAFIQYVEKIYFQKKLESS
EWNISQTAEESQVSRPFIYKKINELELKQNVTS
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaacagtcacgaaattaatgaatgacgatgtcactacgctatttgtaacggat
ggtgagggaaatattttattagcaaatgaatttacggctatgacattaggaatgccgttg
aatacgttgttgaattcaaatgtttatgatttagttgcaagtaacatatacaatgcttca
gctacaatcgaaacattaaaaacacataaaatgtctgaagtgaatttaacaactaaagct
ggttatcaaataaaatcaaaatcaacgccaattttctatccagataaaacgctacaccta
gttgtaactaagtctgatccgctgacaatcgaagagttagagcgctggacgaaaaatatt
gctgagacttcaaaagaaaccgaggaatttagtgaattagaagtcaatgaaaaagtgatt
gccgaaagtaatgaaatgaagcgagttctgcgagtctgtaaacaagtctcaaaatacaat
agtcgaattctgctattaggtgaatctggtgttggaaaagaagtcgttgctaattacatt
catcagcatagccaactagctgattgtcaattcataacagtcaactgtgctgcaattcca
gataatttatttgagtcagagttctttggctataaaaaggggaccttcactggggctaaa
gaagataaaattggtttgattgaagccgcggatggtggcactttatttttagatgaaatt
tcagaaatgccactagaaatgcaaacaaaattattacgtgctttagaaacgatgaagatt
cgtaaagttggtgatattgccgaaatcccaatctcttttcgtttaatctcagcatctaac
caagacattttaagtttagtcgaaaaaggtaaatttagacgggatctttactatcgaatt
aatgccattcctgttgtgattcccccattgagggaaagaaaaaaagatgtactcgctttg
gcaaattattttatagactactttaaccaacaacaccagcgaagtatctcattagaaacc
caacatattaagcatttaatgttgtctgaatggtcgggaaatgtccgagaattgaaaaat
tatattgaatacttagtagtcactgcagatcttgatttacccgttcatcaaggaggatac
gaaacaccttcaaatgatcaaatcgaagagtctttacaagcgattgccggggaatgtgat
tatcaagcatttatccagtacgttgaaaaaatttattttcaaaaaaaattagagtctagt
gaatggaatattagccaaacagccgaagaaagccaagtcagccgtccttttatttataag
aaaattaacgaattagaattgaaacaaaatgtgacatcttaa

DBGET integrated database retrieval system