KEGG   Carnobacterium maltaromaticum: BN424_859Help
Entry
BN424_859         CDS       T02342                                 

Gene name
fabK
Definition
(GenBank) 2-nitropropane dioxygenase family protein
Organism
cml  Carnobacterium maltaromaticum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NMO IMPDH ThiG FMN_dh His_biosynth DHO_dh Glu_synthase Pyr_redox_dim DUF561
Motif
Other DBs
NCBI-ProteinID: CCO10323
UniProt: K8EEV5
Position
918799..919731
Genome map
AA seq 310 aa AA seqDB search
MKQITEILGIKYPIFQGAMAQISKHQLAAAVSNAGGLGIIASGGMTEEQLREEVIQCKKL
TDKPFAVNIMLMAPNVPDMVKVVVEEGVKIVTTGAGTPKNYMETFKEANIKVIPVVPSAI
LAKKMEAIGATAVVAEGSEAGGHIGELSTMVLLPQVVAAVKIPVIAAGGIGCGKGMAAAY
TLGAQGVQMGTAFMLANECPIPENVKEFIANAKEMDTAVTGRNGGAPVRSLKNKMIEQYI
QWEKENMPREQLEELTMGSARKAAAGDIENGSVMAGQVSGLINEVKSAQQIVDDVLAEAK
VTIKNVQLNF
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagattactgagatattaggcattaagtatcctatattccaaggtgcaatggca
caaatatcaaagcatcaattagccgctgcagtttctaatgcaggaggattagggattatt
gcttccggtggtatgactgaagaacagttaagggaagaggtgattcagtgcaaaaagtta
acggataaaccttttgctgtcaatattatgctaatggccccaaatgtgcctgatatggtt
aaagtcgttgttgaagaaggcgttaaaattgtcacaacaggagcaggaacgcctaaaaac
tatatggaaacgtttaaagaagcaaatattaaggtcattccagttgtaccaagtgctatt
ttagcgaaaaaaatggaagcaatcggtgctactgcagttgtcgcagaaggctcagaagca
ggtggacatataggtgaattatcaaccatggtgttacttccacaagtggttgcagctgtc
aaaattccagttattgctgcaggtgggattggctgtggcaaagggatggctgctgcctat
accttaggtgcccaaggagttcaaatgggaactgctttcatgctggctaatgaatgtccc
attcctgagaatgttaaagaatttattgcaaatgccaaagaaatggatacggcagttaca
gggcgtaacggtggtgctccagttcggagtttgaaaaacaaaatgattgagcagtatatt
caatgggaaaaggaaaatatgcctagagaacaattggaagaattaaccatgggatcagct
cgtaaagcggcagctggtgatattgaaaatggttccgtaatggcggggcaagtctcaggt
ttaataaatgaagtcaaatcagcgcaacaaattgtcgatgatgtattagcagaagcgaaa
gtaacgattaaaaatgtacaattaaacttttag

DBGET integrated database retrieval system