KEGG   Carnobacterium maltaromaticum: BN424_862Help
Entry
BN424_862         CDS       T02342                                 

Definition
(GenBank) antibiotic biosynthesis monooxygenase family protein
Organism
cml  Carnobacterium maltaromaticum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABM
Motif
Other DBs
NCBI-ProteinID: CCO10326
UniProt: K8EPB2
Position
complement(921375..921665)
Genome map
AA seq 96 aa AA seqDB search
MLKLIAEDYIKLEHLETVKPLYRELVEKTQLEPDCLAYNLFVDQKDPGHFIFIEEWPNEL
ALEKHCNSEHFTRLVPLINSYQSKPGTFLRMDAFQK
NT seq 291 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaattaattgcagaagattatatcaagctagaacatctagaaacagtcaaacca
ctttatcgcgaattggttgaaaaaacccagcttgaacctgattgtctcgcatataatctt
tttgttgatcaaaaagatccaggacattttatctttattgaagagtggcctaacgagcta
gctttggaaaagcattgcaactctgaacactttacacgcttagttccattaattaattct
tatcaaagtaaaccagggacttttttaagaatggatgcattccaaaagtag

DBGET integrated database retrieval system