KEGG   Carnobacterium maltaromaticum: BN424_867Help
Entry
BN424_867         CDS       T02342                                 

Definition
(GenBank) conserved hypothetical protein
Organism
cml  Carnobacterium maltaromaticum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AIM24
Motif
Other DBs
NCBI-ProteinID: CCO10363
UniProt: K8EF13
Position
925745..926419
Genome map
AA seq 224 aa AA seqDB search
MKYSIEGDTLPVVICELEKGEAMVSENGGRSWALGEITTETTSGGGMKKMLGRAFSGESL
FLSRYEAQSNATIAFASSFPGCIIAKELQAGESVIAQKTAFLAATEGVELSTFFQKKGTA
GFFGGEGFIMQKLQGPGTVFFEIDGSTKTYDLAAGERLVCDTGLVALMDETCKLEIVAVK
GLKNKLLGGEGFFDTVVTGPGKVTVQTMTLGGFAQSILPFMSSK
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
gtgaagtattcaattgaaggcgatacattgccagtagttatttgtgagttggaaaaaggt
gaagcgatggtgagtgaaaatggtggacgtagttgggcattaggtgaaattactactgaa
acaacctctggtggcgggatgaaaaaaatgttaggcagagctttttcaggcgaaagttta
tttctaagtcgttatgaagctcaaagtaatgcaacaattgcttttgcttcttcctttcca
ggctgtatcatagctaaagaacttcaagccggtgaaagtgttattgcgcaaaaaacagct
ttcttagctgcaacagaaggtgtagaactaagcacatttttccaaaaaaagggaacagca
ggtttctttggtggagaaggctttattatgcagaaattacaaggtccaggaactgtcttt
tttgaaattgatggcagtacaaaaacgtatgacttagctgcaggcgaacgtctagtttgt
gatacaggtttagttgctttaatggatgaaacttgtaagttagaaattgtagctgttaaa
gggttaaaaaataagttattaggtggagaaggtttctttgatactgtggtaactggtcct
ggaaaagtaactgtccaaacgatgacattaggtggatttgcacaaagtattttacctttc
atgtcttctaaataa

DBGET integrated database retrieval system