KEGG   Carnobacterium maltaromaticum: BN424_872Help
Entry
BN424_872         CDS       T02342                                 

Definition
(GenBank) lin1944 protein
Organism
cml  Carnobacterium maltaromaticum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 Epimerase adh_short KR RmlD_sub_bind
Motif
Other DBs
NCBI-ProteinID: CCO10336
UniProt: K8EPC2
Position
930484..931086
Genome map
AA seq 200 aa AA seqDB search
MKKALIIGGNGTIGSAVSNALNDSYEIITAGRTHGDVKVDITSVESITRLFEIVGEVDAV
IITAGQAHFGALKDMTPQDNLISVNSKLLGQVNTVLIGTNYVKDHGSFTLVTGIMMDDPI
LAGASAALANGGVKAFAKSAALELPRGIRINTVSPNVLEESWENYKDFFIGFNPVSARKV
ANAFVKSVKGGQTGQSYEVY
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagcattgataatcggaggaaacggaactattggctctgctgtttcaaatgcg
ttgaatgattcctatgaaataattactgcaggacgtacccacggagatgttaaagtcgat
atcacctcagtcgagagtattacgcgattatttgaaatagttggagaagttgacgcagtc
attattacagctggccaagctcatttcggagcattaaaagacatgacaccgcaagataat
ttaatcagtgttaacagtaagcttttaggtcaagtgaatactgttttaattggaacaaac
tatgtgaaagatcatggcagttttacattagtaactggaatcatgatggatgatcctatt
ttagcgggcgcttccgctgccttagccaatggtggggtaaaagctttcgctaaatccgct
gctttggaactgccacgtggaattcggataaatacagttagtcctaatgtgttagaagaa
tcgtgggaaaattataaagacttctttattggttttaatcctgtctcagcaagaaaagta
gcaaatgcttttgttaaaagtgtcaaaggcggacaaactggacaaagctacgaagtctat
taa

DBGET integrated database retrieval system