KEGG   Carnobacterium maltaromaticum: BN424_873Help
Entry
BN424_873         CDS       T02342                                 

Gene name
secG
Definition
(GenBank) preprotein translocase, SecG subunit
  KO
K03075  preprotein translocase subunit SecG
Organism
cml  Carnobacterium maltaromaticum
Pathway
cml02024  Quorum sensing
cml03060  Protein export
cml03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:cml00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03060 Protein export
    BN424_873 (secG)
 Environmental Information Processing
  Membrane transport
   03070 Bacterial secretion system
    BN424_873 (secG)
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    BN424_873 (secG)
Secretion system [BR:cml02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components [MD:M00335]
   BN424_873 (secG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SecG Ac76 ODV-E18 Asp5 DUF3671
Motif
Other DBs
NCBI-ProteinID: CCO10337
UniProt: K8E2M5
Position
931245..931484
Genome map
AA seq 79 aa AA seqDB search
MYNALLLAMLVISVLLIIVITMQPTKTNSASSALTGGAEQLFGKQKARGFEAVLQRVTVI
LGIAFFVIALVLAYVTAQG
NT seq 240 nt NT seq  +upstreamnt  +downstreamnt
ttgtataatgcacttttacttgctatgttagtaatttcggttttattaattattgttatc
accatgcaacctacaaagacaaatagtgcctcaagtgccttaacaggtggcgcggagcaa
ttattcggtaaacaaaaagctcgcggatttgaagcagttttgcaacgtgtaacagttata
ttaggaattgcattttttgtaattgcactagtacttgcttatgtaacagcccaaggctaa

DBGET integrated database retrieval system