KEGG   Carnobacterium maltaromaticum: BN424_876Help
Entry
BN424_876         CDS       T02342                                 

Gene name
smpB
Definition
(GenBank) ssrA-binding protein
  KO
K03664  SsrA-binding protein
Organism
cml  Carnobacterium maltaromaticum
Brite
KEGG Orthology (KO) [BR:cml00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99975 Protein processing
    BN424_876 (smpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SmpB
Motif
Other DBs
NCBI-ProteinID: CCO10340
UniProt: K8E2S1
Position
934950..935408
Genome map
AA seq 152 aa AA seqDB search
MPKHEGKLVAQNRKARHDYTIIDTIEAGMVLQGTEIKSIRGARINLKDGYARIYKDEIYL
HNVHISPYEQGNQFNHDPLRIRKLLMHKKQIARLVNETKGTGITLVPLKVYIKNGYAKVL
IGLAKGKKNYDKREDLKRKDAKRDLDRTMKIR
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaacacgaaggcaaattagttgcccaaaatcgaaaagcacgccatgattatact
attatcgatacaatagaagctggtatggttttacagggcactgaaattaaatcaattcga
ggagctcgaattaatttaaaagatggttatgcacgtatttataaggatgaaatctattta
cacaatgtccatattagtccttatgaacaaggcaatcagtttaatcatgatccacttcga
attcgcaaactattaatgcataaaaaacaaattgcccgtctagtaaatgaaactaaagga
acaggaattaccttagtccctttaaaagtttatataaaaaatggctatgcaaaagtctta
attggattagctaaagggaagaaaaactatgataagcgtgaagatttaaaacgcaaagat
gcaaaacgtgacttggatcggacgatgaaaatcagatag

DBGET integrated database retrieval system