KEGG   Carnobacterium maltaromaticum: BN424_880Help
Entry
BN424_880         CDS       T02342                                 

Gene name
mrdB
Definition
(GenBank) rod shape-determining protein RodA
  KO
K05837  rod shape determining protein RodA
Organism
cml  Carnobacterium maltaromaticum
Brite
KEGG Orthology (KO) [BR:cml00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cml03036]
    BN424_880 (mrdB)
Chromosome and associated proteins [BR:cml03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Other chromosome partitioning proteins
    BN424_880 (mrdB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTSW_RODA_SPOVE
Motif
Other DBs
NCBI-ProteinID: CCO10344
UniProt: K8E2T6
Position
939347..940495
Genome map
AA seq 382 aa AA seqDB search
MTKEKNNEQNFAIVLLLMILALISLATIHSATGGWHYVIMQGAWYLVGAVIVFIVMQFDS
EQLWKLAPVAYGIGIILLIAVLIVGVEINGSTRWINLGFMNFQTSEVMKIAFILTLARLL
TSHNRKVMNRTIKSDSWLLTKIVLLSLPPIGLIMLQSDLGTTIVFIAIIAGMTLLSGVSW
KILGPLIGIVSSILIGMFCLILFNREILYKIGFHSYQFDRVDVWLDPYLDVSGDSYQSIQ
SMKAIGSGQIGGKGFGMSEVYVPENHTDFIFTVLGENFGFIGSAILLFVYFLLIYRFVLT
CFKIRNEFYSYIVTGVIMLVSFHIFENIGMTIGLLPVTGIPLPFISYGGSSLLGNMIAVG
LVLSMNHHNHDYIFSEKDKNFE
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaagaaaaaaataatgaacaaaattttgcaattgtcttgttattgatgatttta
gctttaattagtttagcaacgattcatagtgcgactggtggatggcactatgtgattatg
caaggagcatggtacttggtgggggcagtgattgtctttatcgtgatgcaatttgatagt
gaacaactttggaaactagctccagtcgcttatgggattggaattattcttttaattgct
gttttgatagttggagttgaaattaatgggtctacgagatggatcaatttaggctttatg
aattttcaaacttctgaagtaatgaaaattgcatttattttaactttagctcgactatta
actagtcacaatcgaaaagtaatgaaccgaacgataaaatcggatagttggttgttgact
aaaattgttcttttaagtttaccaccaataggattaattatgttacaatcagatttaggg
acaacgattgtttttattgcgattattgcaggaatgaccttattatcaggcgttagttgg
aaaattttaggacctctaattggaattgttagcagtattttaattggtatgttttgttta
atattatttaatcgcgaaattctttataaaattgggtttcacagttatcaatttgatcgg
gttgatgtgtggttagatccttatctagatgtttctggggactcttatcaatcaattcag
agtatgaaggcgattggttcaggacaaataggtggaaaaggctttgggatgtcagaagtt
tatgttcctgaaaatcatacagattttatttttaccgttttaggagaaaattttggattt
atcggaagtgctatactgctgtttgtttattttttactgatttatcgttttgttttaact
tgtttcaaaattagaaatgaattttattcttacattgtgactggggttattatgctggtt
agttttcatatttttgaaaatattggtatgacaattggcttgcttccagtgacgggaatt
ccattaccgtttattagctatggagggtcctctttattagggaacatgattgccgttggt
ttagtattatccatgaaccatcataatcatgattatattttttctgaaaaagataaaaat
tttgagtaa

DBGET integrated database retrieval system