KEGG   Carnobacterium maltaromaticum: BN424_881Help
Entry
BN424_881         CDS       T02342                                 

Gene name
ftsW
Definition
(GenBank) cell cycle family protein
  KO
K03588  cell division protein FtsW
Organism
cml  Carnobacterium maltaromaticum
Brite
KEGG Orthology (KO) [BR:cml00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cml03036]
    BN424_881 (ftsW)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cml02000]
    BN424_881 (ftsW)
Chromosome and associated proteins [BR:cml03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    BN424_881 (ftsW)
Transporters [BR:cml02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   BN424_881 (ftsW)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTSW_RODA_SPOVE
Motif
Other DBs
NCBI-ProteinID: CCO10345
UniProt: K8E2S4
Position
940539..941663
Genome map
AA seq 374 aa AA seqDB search
MKKIDYYLLVPYLTLIFIGSLMVYSASADVSLVQYGTGTKYFVGQLVFIGAGMTMLVITS
QLKMSFLKNKNLVLCLFFAMLLLLASVLIIGENINGAKRWIDIGFFNIQPVEISKLVLVW
YTAYILSRRQSQMQRNWFKAILPPIVIVGISSLLILLQPDAGSVIIIAIVIVVQIFASGM
PFKIGMISSLAASGVIAGYLKLLTIYGAKMPGMSTYRYARFEAFWNPFELADSSGMQLSG
SYLALGRGGVFGVGLGKSVLKKGYLPEPHTDFILAIIGEEFGLIGVCLILVALSTLILRI
FYLANHTKDSFSSLLCIGIGTMMLIQTGINIGGVIGLVPISGVTLPFVSYGGSSILILSI
ALGLVFNVSRRITK
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatagattattatttgctagtaccttatctgacattgatctttataggttct
ttaatggtctatagtgcaagcgcagatgtttctttggtacaatatggcacaggtactaaa
tattttgttggtcagcttgtctttattggtgctgggatgacgatgcttgttataactagc
cagcttaaaatgagctttttaaaaaataaaaatttagttttatgtttattttttgcgatg
ctacttttgttagcttcagttttaataattggtgagaatattaatggtgctaagaggtgg
atcgacattggttttttcaatatccaaccagttgaaatttcaaagttagtcttagtttgg
tatactgcgtatattttatctcgtcggcaatcacaaatgcaaagaaactggtttaaagct
attttaccccccattgttatagtaggaattagttctttgctgattttgctacaaccagat
gctggtagtgtcattattattgcaattgttattgtagttcaaatttttgcaagtgggatg
ccttttaaaattgggatgattagtagtttggctgcttcaggagtgattgctgggtactta
aaattacttacgatttatggagcaaagatgccagggatgtcaacctatcgctatgcccgt
tttgaagctttttggaacccttttgaattagccgatagttctggtatgcagttaagcggt
tcctatttagctttaggccgaggtggtgtttttggtgttggtttgggaaaaagtgttctg
aaaaagggctacttgcctgagccacatactgattttatcctagctattattggggaagaa
tttggattgatcggggtttgccttattttggtagcattaagtacgctgattttacgtatc
ttttatttagcaaatcatacaaaagattctttttcttccttactttgcatagggataggg
acgatgatgttgattcaaacgggaattaatattggtggtgtgattggacttgtgccgatt
agtggggttactttaccttttgttagttatggtggatccagtattttaatactatcaatc
gcactggggctagtttttaatgtgagtcgaagaataactaaatag

DBGET integrated database retrieval system