KEGG   Carnobacterium maltaromaticum: BN424_884Help
Entry
BN424_884         CDS       T02342                                 

Gene name
tnp
Definition
(GenBank) transposase, Mutator family protein
Organism
cml  Carnobacterium maltaromaticum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transposase_mut MULE GED Cut12
Motif
Other DBs
NCBI-ProteinID: CCO10348
UniProt: K8EEY4
Position
complement(942693..943853)
Genome map
AA seq 386 aa AA seqDB search
MTQVHFTLNTEKVPRIIEYSIKDDVSKNILTTVFNQLMDNQRTEYIQAEHYERSENRQSQ
RNGYYERNYTTRVGTLELKVPRTRDGKFSPTIFERYHRNEKALLASMIEMYVSGVSTRKV
SKIVEELCGKSVSKSFVSSLTEQLDPMVNECQNHLLSEKNYPYLMTDVLYIKVREENRVL
SKSCHIAIGISKDGDREILGFMIQNEESEDTWSYFFEHLKNRGLRGTELVISDAHKGLVS
AVRQSFLNASWQRCQVHFLRNILTSIPKKNSKPFREAVKAIFKFTDINLARVAKNRLVSD
YIDQVKYSKACETLDNGFEDAFQYTLFGNVHNRLKSTNLLERLNQEVRRREKNIRIFANC
VSANRLIGAVLIDQHDEWVCSSSKIY
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgacccaagtacattttacactgaataccgaaaaggttccaaggattattgaatattcc
ataaaagatgacgtgtctaaaaatattttgaccacggttttcaatcaattaatggacaat
caaagaaccgaatacattcaagccgaacactatgaacggtctgaaaatagacaaagtcaa
cgaaatggatactacgagaggaactatacaacacgtgttggtacacttgaattaaaagta
cctagaacacgtgatggcaagttttctcctacgatatttgaacgatatcacagaaatgaa
aaagccttgcttgcttcaatgattgagatgtatgtctccggtgtttctacacgaaaagtt
tcaaaaattgttgaagaactgtgtgggaaatcggtgtctaaatcctttgtttctagtctg
actgaacagttagaccctatggtcaatgagtgccagaatcacttgctctcagagaaaaat
tatccatacttgatgacagatgttctttatataaaagtacgagaagagaatagagttctt
tctaaaagctgccatatcgctattggaataagcaaagacggggatcgtgagatcctcgga
ttcatgattcaaaatgaagaaagtgaggatacctggtcctacttctttgaacacctaaaa
aacagaggattacgaggaactgaacttgtgatttccgatgctcataaaggcttagtttct
gcggttcgtcagtcgtttctcaatgcaagttggcagagatgtcaagttcactttttaaga
aacatccttacgagtattcctaaaaagaattcaaaaccttttagagaggccgtaaaagca
atctttaaatttacagatatcaacctagcacgggtagctaaaaatcgcctggtcagtgac
tatattgaccaggtaaaatattcaaaagcttgtgaaaccctggacaatggcttcgaagat
gcttttcaatataccttatttgggaatgtccacaatcgtttaaaaagtaccaaccttctt
gagcgattgaaccaagaagtgcgcagaagagaaaaaaatattcgtatctttgcaaactgc
gtttcagccaatcgtttaatcggagcagtccttattgatcaacacgatgagtgggtttgt
tcatcaagtaaaatatattaa

DBGET integrated database retrieval system