KEGG   Carnobacterium maltaromaticum: BN424_903Help
Entry
BN424_903         CDS       T02342                                 

Definition
(GenBank) hypothetical protein
Organism
cml  Carnobacterium maltaromaticum
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: CCO10367
UniProt: K8E2Q0
Position
962164..962364
Genome map
AA seq 66 aa AA seqDB search
MTKSVTSNFPIFLPELIGSINFLLRPVLMSQLFGKKMKFRGDKKRHIKFPYFSARANRLN
KLFIKE
NT seq 201 nt NT seq  +upstreamnt  +downstreamnt
gtgacaaaaagcgtcacatcaaatttccctatttttctgccagagctaatcggctcaata
aactttttattaaggccagttcttatgagccaactcttcggaaaaaagatgaaatttcga
ggtgacaaaaagcgtcacatcaaatttccctatttttctgccagagctaatcggctcaat
aaactttttattaaggagtag

DBGET integrated database retrieval system