KEGG   Carnobacterium maltaromaticum: BN424_909Help
Entry
BN424_909         CDS       T02342                                 

Definition
(GenBank) methyltransferase domain protein
Organism
cml  Carnobacterium maltaromaticum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_31 Methyltransf_12 Methyltransf_25 Methyltransf_23 Methyltransf_11 Ubie_methyltran Methyltransf_16 TehB MTS DREV Methyltransf_9 MethyltransfD12 Cons_hypoth95 tRNA_U5-meth_tr NodS PrmA Methyltransf_2 Methyltransf_28
Motif
Other DBs
NCBI-ProteinID: CCO10373
UniProt: K8EF25
Position
967198..967815
Genome map
AA seq 205 aa AA seqDB search
MGNIDVFNRVASKYDTPERSEIAKITAKEIQKHIVNGKDKTAIDYGCGTGLVGLELVADF
ETLLFADASQSMVEVVETKIEQATIKNAKTLLLDIEEVSNSDIQVDYIFLVQVLLHVQDI
QPLLSNLYKLLKPNGHLLIVDFDYNEQVNSDKVHNGFKQQELIQLMGKIGFVESNAEIFY
HGKNIFMNQDASFFILDAAKPVLND
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atggggaatattgatgtatttaatcgagtagctagtaagtacgatacacctgagagaagt
gaaattgcaaaaatcacagctaaagaaatccaaaagcatattgtgaatggaaaagataaa
acagcgattgattatggctgtggaacaggcctagttggactggaattggtagctgatttt
gagacacttctttttgcggatgcctctcaaagtatggtagaggttgtggaaacaaaaatt
gaacaggctactattaaaaatgctaaaacccttcttttagatattgaagaggtgtcaaat
agtgatatacaagtagattatatctttttagtacaagtgcttcttcatgtacaagatatt
caacccttactatcaaatttatataaattattaaagccgaatggtcatttgttgattgtt
gattttgattataacgaacaggttaattcagataaagttcataatggctttaaacagcaa
gagctcattcaactaatgggaaaaattggatttgtagaatcgaatgctgaaatattttat
catgggaagaatatttttatgaatcaggatgcctcattctttattttagatgcagctaag
cctgttttaaacgattag

DBGET integrated database retrieval system