KEGG   Carnobacterium maltaromaticum: BN424_912Help
Entry
BN424_912         CDS       T02342                                 

Gene name
pisI
Definition
(GenBank) putative piscicolin 126 immunity protein
Organism
cml  Carnobacterium maltaromaticum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EntA_Immun Phi-29_GP16_7 STELLO DUF892
Motif
Other DBs
NCBI-ProteinID: CCO10376
UniProt: K8EPH4
Structure
PDB: 

Position
complement(970543..970839)
Genome map
AA seq 98 aa AA seqDB search
MGKLKWFSGGKERSNQAENIITDLLDDLKTDLDNESLKKVLENYLEELKQKGASVPLILS
RMNLDISKAIRNDGVTLSDYQSKKLKELTSISNIRYGY
NT seq 297 nt NT seq  +upstreamnt  +downstreamnt
atgggtaagttaaaatggttttctggaggaaaagaacgatcaaatcaggcagaaaacatt
atcactgatttattagatgatttaaaaacagacttagacaatgaatcgctaaaaaaagtg
ttagaaaattatcttgaagagttaaaacaaaagggcgcttctgttcctctgattttaagt
cgaatgaacttagatatttctaaagcaatcagaaatgatggcgttactttatctgactat
caatcaaaaaaacttaaagagttgacttctatctccaatattagatatggatattag

DBGET integrated database retrieval system