KEGG   Carnobacterium maltaromaticum: BN424_915Help
Entry
BN424_915         CDS       T02342                                 

Definition
(GenBank) putative uncharacterized protein
Organism
cml  Carnobacterium maltaromaticum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cyclophil_like
Motif
Other DBs
NCBI-ProteinID: CCO10379
UniProt: K8E2X1
Position
972660..972998
Genome map
AA seq 112 aa AA seqDB search
MNIIIGKQLFQIELVSNQATKELIARLPINLKMNDLHGNEKYAYFSEILPTQEEKVDEIK
KGDIMLYGSDCLVLFYKTFSTNYSYTKIGKVKEVDQLDFISEIETINVILVK
NT seq 339 nt NT seq  +upstreamnt  +downstreamnt
atgaatataataatcggcaagcaactctttcaaattgaattggtatctaatcaagcaaca
aaagaattaattgctagacttccaataaatctaaaaatgaatgatttacatggcaatgaa
aaatatgcttatttttcagaaatattgccaacacaggaagaaaaagtagatgaaattaaa
aaaggagatattatgctttatggttcagattgccttgtcctcttttataaaacattctct
accaattactcatatactaaaataggcaaagttaaggaagttgatcaactcgatttcatt
tcagaaatagaaacaatcaacgtcatattagtaaaataa

DBGET integrated database retrieval system