KEGG   Carnobacterium maltaromaticum: BN424_917Help
Entry
BN424_917         CDS       T02342                                 

Definition
(GenBank) hypothetical protein
Organism
cml  Carnobacterium maltaromaticum
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: CCO10381
UniProt: K8EPH9
Position
973784..973897
Genome map
AA seq 37 aa AA seqDB search
MKYQNRIKAKIRFLFHGESEIGTNLNYGILAKNWFDV
NT seq 114 nt NT seq  +upstreamnt  +downstreamnt
atgaaataccaaaaccgaatcaaggctaagattcggtttttatttcatggagaaagtgaa
attggtaccaatcttaattatggtattctagcaaaaaactggtttgatgtatag

DBGET integrated database retrieval system