KEGG   Carnobacterium maltaromaticum: BN424_918Help
Entry
BN424_918         CDS       T02342                                 

Definition
(GenBank) aldo/keto reductase family protein
Organism
cml  Carnobacterium maltaromaticum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldo_ket_red
Motif
Other DBs
NCBI-ProteinID: CCO10382
UniProt: K8E2Q6
Position
974032..975012
Genome map
AA seq 326 aa AA seqDB search
MEYTKLGNTGLDVSRICLGTMSFGDPKNWIHKWVLEEEDSRPLIKRALELGINFFDTANV
YSLGRSEEILGQALKDYANRDEIVLATKVHQKMFDGPNGQGLSRKAIMSQIDQSLNRLQT
DYVDLYIIHRWDPFTPIEETMEALNDVVKAGKARYIGASAMYAYQFQKANNIAEKNGWTK
FVSMQNHLNLIYREEEREMIPYCLSEKIALTPYSPMASGRLIRSATEVTKRSTTDNAQKA
KYDETADKDQMIIDRVAELAAKYETNKVNIALGWLLQKNPVVAPVIGATKMNHIETAVGA
VDFKLSQADILYLEEPYIPHKVIGHA
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atggagtatacaaaattaggaaatactggtctagatgtttcaaggatttgcttaggtaca
atgagctttggagaccctaaaaattggattcataaatgggtccttgaagaagaagatagt
agaccgctaattaaaagagcactagaacttggtatcaacttttttgatactgcaaatgta
tattctttaggtagaagtgaagaaattttaggtcaagcattgaaagactatgcaaatcgg
gatgaaattgtactagcaacaaaagttcatcaaaaaatgtttgatggtccaaatggacaa
ggattatcaagaaaagctattatgtctcaaatagatcaaagtttgaaccgtttgcaaact
gactatgtagatttatatatcattcatcgctgggatccatttacaccaattgaagaaaca
atggaagcattaaatgatgttgttaaagctggaaaagcaagatatataggggcttctgcg
atgtatgcttatcaatttcaaaaagcaaataatatagcagaaaaaaatggatggacaaaa
tttgtctcaatgcaaaatcatttaaatttgatttatcgtgaagaagaacgtgaaatgata
ccttattgtctttcagaaaaaattgcactcacaccatatagtccaatggcatcaggtcga
ttaattcgaagcgctacagaagtaaccaaacgaagcactacagataatgcacaaaaagct
aaatatgatgaaacggctgacaaagatcagatgattatagatcgagtggctgagttagca
gctaaatatgagacgaataaagttaatattgccttaggatggttacttcaaaaaaatcct
gtagtggcacctgtcattggtgcaactaaaatgaaccatattgaaacagctgtaggagct
gtggatttcaaattaagccaagcagacattctttatttggaggaaccttatattcctcat
aaagtaatagggcatgcttaa

DBGET integrated database retrieval system