KEGG   Carnobacterium maltaromaticum: BN424_919Help
Entry
BN424_919         CDS       T02342                                 

Definition
(GenBank) putative uncharacterized protein
Organism
cml  Carnobacterium maltaromaticum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lactamase_B_2 Lactamase_B_3 Lactamase_B Lactamase_B_6
Motif
Other DBs
NCBI-ProteinID: CCO10383
UniProt: K8EF33
Position
complement(975053..975856)
Genome map
AA seq 267 aa AA seqDB search
MMNKLPQATPPKTIPFGPEAFQKSNHTEIRWLGNSGIFLNSRGYCMMVDPVLEGFDLPLL
IDMPIKTDQVPHLDSILITHSDNDHFSIPTLEKLLPLTTALHAPKYVAGLVKEKINHEAI
GHDIHASFDDGPLKITLTPADHLWQNESKKYDRIFKLEDFCGFWIETPDGTLWIPGDSKL
LPSHLEMPEPNAILFDFSDNEWHIGLDNAIKLANTYPNADLILSHWGTVDAPQMNVFNGN
PADLLHRVDNPERIQIVAAGDVFILEK
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgatgaacaaactaccacaagcaacaccaccaaaaacaattccttttggcccagaagct
tttcaaaaaagtaatcatactgaaatcagatggctgggaaattcaggtatatttttaaat
agtagaggctattgcatgatggtcgatccagttttagagggcttcgatttacctttattg
attgatatgccaataaaaacagatcaagtgccacatttagatagtattcttatcacccat
tcagacaatgatcattttagtataccaactttagaaaaattactgcctttgacaacggct
ctccacgcaccaaaatatgtagcgggcttggtcaaagaaaaaataaatcatgaggcaatt
ggtcatgatatacatgcttcttttgatgatggtcccttaaaaataactttaacacctgct
gatcatttatggcaaaatgaaagtaaaaaatatgatcgtatctttaaattagaagacttt
tgcggattttggattgaaacacccgatggaaccttatggattcctggagattccaaattg
ttgccatcccatttagaaatgcctgaacctaatgctattctctttgatttttctgataat
gaatggcatattggcttagataacgcgattaaacttgctaatacctatccaaatgctgat
ttgattttatctcattggggcacagttgatgctcctcaaatgaatgtttttaatggaaat
ccagctgacctacttcatagagtagacaatcctgaaagaatccagatagttgctgctgga
gatgtttttattttagaaaaataa

DBGET integrated database retrieval system