KEGG   Carnobacterium maltaromaticum: BN424_923Help
Entry
BN424_923         CDS       T02342                                 

Gene name
bglP
Definition
(GenBank) PTS system, beta-glucoside-specific IIABC component family protein
  KO
K02755  PTS system, beta-glucoside-specific IIA component [EC:2.7.1.-]
K02756  PTS system, beta-glucoside-specific IIB component [EC:2.7.1.-]
K02757  PTS system, beta-glucoside-specific IIC component
Organism
cml  Carnobacterium maltaromaticum
Pathway
cml02060  Phosphotransferase system (PTS)
Module
cml_M00271  PTS system, beta-glucoside-specific II component
Brite
KEGG Orthology (KO) [BR:cml00001]
 Environmental Information Processing
  Membrane transport
   02060 Phosphotransferase system (PTS)
    BN424_923 (bglP)
Enzymes [BR:cml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.-  
     BN424_923 (bglP)
Transporters [BR:cml02000]
 Phosphotransferase System (PTS)
  Enzyme II [TC:4.A]
   Beta-glucoside-specific II component [MD:M00271]
    BN424_923 (bglP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTS_EIIA_1 PTS_EIIC PTS_EIIB MutS_I
Motif
Other DBs
NCBI-ProteinID: CCO10387
UniProt: K8E2Q9
Position
977868..979715
Genome map
AA seq 615 aa AA seqDB search
MSKKYEKLAQEIVEKLGGKENISDAYHCQTRLRFKLIDEQKVDKEELEELDGVATYLVNA
GVHQVVIGTHVKDVFEEIDKKVDVSEQNKAPSDKKSVFNIIIEFVAGTFQPIIPALSGAG
MVKAVLALLVVFKIVSVESQTYYLLNLFADGVFFFLPMMLAFTVAQKLRCNPILAASVAA
MMMHPNWGTLVAAGEPVKFFDIIPFNLATYTGSVIPILLIILVQSYVEKFLNRVIPKSVE
LVFVPMLTFLIMGTLAFSVLGPIGSIIGGYLAGFFMFLSMNASWVPAVLIGGFLPIMVMF
GLHNGVAPLGVMQMAELGYDSIFGPGCVCSNIAQATASAVVAFRTKDKKMKQLAVSGSIT
AYMGITEPTLYGVNLPKKYPLVAAMIGGGAGGLYAGLTNTHRFATGSSGLPAILLYIGDN
SMVFFWNIVIALLISAVVSAVLTYILSFKFEKEVDLPSVKEVILEDATVSNPIKGNIIPL
NEVKDGAFASGALGKGFAIEPIEGKVIAPFNGKIEAVFPTKHAIGLVSETGIELLIHVGL
NTVELKGQYFDTLVEPGQTVKKGQAILNFDLEKIKESGYETQVPVVITNSPQYSSIELTN
KGKLLNNEEVLIVKV
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaaaatatgaaaaattagctcaagaaattgttgagaagttaggtggaaaagaa
aatatttcagatgcgtatcattgtcaaactcgtcttcgttttaaattaatagatgagcaa
aaagtagataaggaagaacttgaggaactagatggagtagcaacttatttggttaacgct
ggggttcatcaagttgtaataggcacacatgtgaaagatgtctttgaagaaattgataag
aaagttgatgttagtgaacaaaataaggcaccatcagataaaaaaagtgtgtttaatatc
attattgagtttgtagctggtacattccaaccaattattcctgcattatctggggctggt
atggtgaaggctgttctagcattgctagttgtttttaaaattgtttctgtagaatcacaa
acctattatttattgaacttatttgcggacggcgtctttttcttcctaccgatgatgtta
gctttcacagttgctcaaaagttgagatgtaatccaattttggcagcatctgtcgcagca
atgatgatgcatccaaattggggcacattagttgcagcaggggaaccagttaaatttttt
gatattattcctttcaatttagctacatatactggatctgttattccaattcttttaatt
attttggttcagtcttatgtggaaaaattcctcaatcgtgtgataccaaaatcagttgaa
ttagtctttgtaccgatgctgacatttttaattatgggaacattagcattttcagttcta
ggaccaattggtagtattattggcggttaccttgcaggattctttatgtttttaagtatg
aacgcaagttgggtaccagctgtcttgattggtggttttctaccaattatggtaatgttt
ggccttcataatggtgtggctccgttaggcgtgatgcaaatggcagaacttggttatgat
agtatttttggaccaggctgtgtttgctcaaatattgctcaagcaactgcttcagcagta
gttgcttttagaacgaaagataaaaaaatgaagcagttggctgtttctgggtcaattact
gcttatatgggtattactgaaccaacattatatggtgtgaatttaccgaaaaaataccca
ttggttgctgctatgattggtggtggagcaggtggtttatatgctggattaaccaataca
caccgctttgcaaccggctcatcaggtttgcctgcaattttactttatattggcgataat
tcgatggtttttttctggaatatcgtgattgctttgttaatttcagcagtggtctcagca
gttttaacttatattttaagtttcaaatttgaaaaagaagtagatttaccatccgttaaa
gaagttattttagaagatgcaacagttagtaatccgattaaaggaaatataattcctttg
aatgaagtaaaggatggagcctttgcttctggtgctcttggaaagggatttgctattgag
ccaattgaaggaaaagtaattgcaccatttaatgggaaaattgaagcagtttttccaaca
aaacatgcgattgggcttgtatcagaaacaggaatagaacttttgattcatgtaggatta
aatactgtagagttaaaaggccaatattttgatactttggtagagccggggcaaacagtc
aaaaaaggacaagcaatcttaaattttgatttagaaaaaattaaagaatcaggctatgaa
actcaagtcccagttgttataacaaatagtccacagtactcgtcaattgaattgactaat
aaagggaaattactcaataacgaagaagtattaatagttaaagtataa

DBGET integrated database retrieval system