KEGG   Carnobacterium maltaromaticum: BN424_935Help
Entry
BN424_935         CDS       T02342                                 

Definition
(GenBank) protein
Organism
cml  Carnobacterium maltaromaticum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transcrip_reg DUF749 Vmethyltransf_C COG2 V_ATPase_I
Motif
Other DBs
NCBI-ProteinID: CCO10399
UniProt: K8E2Y3
Position
991375..991827
Genome map
AA seq 150 aa AA seqDB search
MEEGILMTNYSKKEFKTLGKIEHTIIKLDETLCKMEDTDSKIKHFFEQEKAIHEIKKTIR
EANKLDKLEAKEIEAGAENIAFDEHEEDRIVASIGKHFDKLDGTLEKLDDTDSKVKGYIE
QKKAIHEVKKILHKAGKLEKYTEDELNTPI
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atggaagaaggaattttaatgactaattacagtaagaaagagtttaaaacccttggtaag
attgagcacacaattattaagctggatgaaacgttatgtaagatggaagacacagatagc
aaaatcaaacatttctttgaacaagaaaaagctattcatgaaatcaagaaaacgattcgt
gaagcgaataaactagataaacttgaagctaaagaaattgaagcaggagctgaaaatatt
gcttttgatgagcatgaagaagatcgcattgtcgcaagtattggcaagcattttgataaa
ttagatggtacattagagaaattagatgatacagatagtaaggtaaaaggctatattgaa
cagaaaaaggcaatccatgaagttaaaaagattcttcataaagctggtaaactagaaaaa
tatacagaagatgaattaaatacaccgatttaa

DBGET integrated database retrieval system