KEGG   Carnobacterium maltaromaticum: BN424_945Help
Entry
BN424_945         CDS       T02342                                 

Gene name
arcD
Definition
(GenBank) transporter, basic amino acid/polyamine antiporter family protein
  KO
K03758  arginine:ornithine antiporter / lysine permease
Organism
cml  Carnobacterium maltaromaticum
Brite
KEGG Orthology (KO) [BR:cml00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cml02000]
    BN424_945 (arcD)
Transporters [BR:cml02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   BN424_945 (arcD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_permease_2 AA_permease Spore_permease Transgly_assoc Adeno_PX
Motif
Other DBs
NCBI-ProteinID: CCO10409
UniProt: K8E2Y8
Position
998604..1000055
Genome map
AA seq 483 aa AA seqDB search
MKKKTATKSVLKTQQKVGFLPLMTIVIGSAIGAGIFNLSKDMALGAAPGAVLISWGIVGV
GIIALALCFQNLSDKRPELDSGIFQYAEDGFGKFAGFVSAWGYWLSIWLGNVAFATMLMS
SLGFFFPIFKGGQNIPSIIGASILLWLLNYLVAKGVENAAFINFVVTVCKLMPIFVFIVF
AIMAFQTSIFTADFWGTMTQQFEFKDVMNQVKSTMLITIFVFVGIEGASILSARARNKKD
VGRATIIGVLCVLVVYMLVTILSFGVMSQNQLANLPEPAMAYVLEEIVGYWGAAFICGGL
SISILGVWLSWTILPAETGLIAAKQGVFPSIFGRINKHGAPAEALTITSMCIQLFMFTFL
ITDQAYQFVASLVSSVVIITYIFVTMYQVKFSYQQPKGRQRTIQLVIGLVATAFQIWAFV
SAGLKFMLLLTLLFVPGIFVYIKAQKEQHQRHFFSPIEKIVVALIFIGSLFAIYFLATGT
ITI
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaagaaaacagcaacaaaatcggttttaaaaacgcaacaaaaagtcggtttttta
ccattgatgacaattgtcataggttcagctattggagcgggtatatttaatttaagtaaa
gatatggcccttggtgcagcgccaggagcagtattgattagttggggtattgttggcgtt
gggattattgcgttggctttatgtttccaaaatttatctgataaaagaccggaattagat
tctgggattttccaatatgcggaagatggttttggaaaatttgctgggtttgttagtgct
tggggatactggctatcaatctggcttggtaatgtagcttttgcaacgatgttaatgagt
agtctaggcttcttctttccaattttcaaaggcggacaaaatattccatcaattattgga
gcaagtattttattatggttacttaactaccttgtggcaaagggcgttgaaaatgcggcc
tttattaattttgttgtcacagtctgtaagttaatgccgatttttgtctttattgttttt
gctataatggcttttcaaacgtctattttcacagcggatttttggggaactatgacgcaa
cagtttgagtttaaagatgttatgaatcaagttaaatcaacaatgttaattacgattttt
gtttttgtcggaattgaaggtgcaagtatcttatctgctcgggctcgaaataaaaaagat
gttggtcgagcaactataattggcgtactttgcgttttagttgtctatatgttggtaacg
attttatcttttggcgtgatgtcacaaaatcaattagctaacctaccagaaccagcaatg
gcttatgttttagaagaaatcgttggatattggggtgctgctttcatttgtggaggttta
tcaatttcgattttaggcgtttggttatcatggacaattttaccagctgaaactggctta
attgctgctaaacaaggcgtatttcctagcatttttgggcgaattaataaacacggagct
ccagcagaagctttaacaatcacaagtatgtgtattcaattatttatgtttactttcttg
atcacagatcaagcgtatcaatttgtggcttcgttagtttctagtgttgtgattattacc
tatatttttgtcacgatgtatcaagttaaattttcttatcaacaaccaaaagggcgtcaa
agaaccattcaattggttattggactagtagcaacggcatttcaaatttgggcctttgtc
agtgctggactaaagttcatgttactgttaactttattatttgtaccaggaatttttgtt
tatatcaaagctcaaaaagagcagcaccaaagacatttcttctcaccaatcgagaaaatt
gttgttgcactaatctttatcggaagcctttttgctatttatttcttagcaactggtacc
attacgatttaa

DBGET integrated database retrieval system