KEGG   Carnobacterium maltaromaticum: BN424_948Help
Entry
BN424_948         CDS       T02342                                 

Gene name
ftsW
Definition
(GenBank) cell cycle family protein
  KO
K05837  rod shape determining protein RodA
Organism
cml  Carnobacterium maltaromaticum
Brite
KEGG Orthology (KO) [BR:cml00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cml03036]
    BN424_948 (ftsW)
Chromosome and associated proteins [BR:cml03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Other chromosome partitioning proteins
    BN424_948 (ftsW)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTSW_RODA_SPOVE
Motif
Other DBs
NCBI-ProteinID: CCO10412
UniProt: K8E2S0
Position
1001421..1002692
Genome map
AA seq 423 aa AA seqDB search
MAKKRHINFPYFLIGATRLNKLFIYKETLENMAENSNSESKIDYGIILSVMLLCIISIAT
IYSTTVIDMGGSIKATIMHIAWYVIGAVAIAVIMQFDSEQLWKLAPIAYWGGIVLLVLVL
FLYDRPTEAVTGAKSWFKIGGLTFQPSEVMKVAFILMMARVVTKHNSRFNQHQPSTDFLL
LGKMFLTAAIPLGLVLVQNDLGTTLVFIAIIGGMVLMSGITWKILLPLFTLGFSTFCGAL
WLVMNDRPFLLKLGFKNYQFARIDSWLNPYHDVSGDAYQLVQSMKAIGSGKVFGKGFGIF
EVYVPVRESDMIFSTIAENFGFIGSCILIFLYFLLIYQMIRVCFDTKNEFYTYISTGVIM
MILFHVLENIGMSIGLLPLTGIPLPFISQGGTALLGNMMAVGLILSMRYHYKSYMFSDEE
KEF
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaaaacgccatatcaattttccctattttcttatcggagctacccggctcaac
aaactttttatttacaaggagactttagaaaacatggcagaaaacagcaatagtgaatct
aaaatagattatggtatcatcttatccgtcatgttactgtgtattattagtatcgcaact
atttattcaacaacagtaattgatatgggcgggagtattaaagcaacgattatgcatatc
gcttggtatgtcattggagctgtggcgattgcggtcattatgcaatttgactcagaacag
ctttggaaattagcaccaattgcctactggggtgggattgtcctgctagtgctggtttta
ttcctttatgatcgaccaactgaagctgtaaccggcgcaaagagttggttcaaaattggt
ggtctgaccttccagccttctgaggtaatgaaagttgcctttatcttaatgatggctcgt
gtcgttacgaaacacaatagccgttttaatcaacatcaaccttcaactgattttttatta
ttaggtaaaatgtttttaacagccgcaattccactaggtcttgtattagttcaaaatgac
ttaggaacaacgttggtatttatagcaatcatcggtgggatggtcttaatgtcaggaatt
acgtggaaaattttgcttccgttatttacactaggatttagtactttttgcggtgcgtta
tggttagttatgaatgaccgaccgttcctacttaaattaggctttaaaaattaccaattt
gctcggattgattcttggttaaatccttatcacgatgtttcaggagatgcttaccagcta
gtacaaagtatgaaagccattggctctggtaaagtatttggtaaaggctttggtattttt
gaagtgtatgtgcctgttagagagtcggatatgatcttctctacaattgcggaaaacttt
ggttttattggaagttgtatattgattttcctttatttcttactaatttatcaaatgatt
cgcgtatgttttgatacgaaaaatgaattttatacctatatttcaactggggttattatg
atgattctattccatgttctggagaatattgggatgagtatcggattactaccattgact
ggtattccattaccgtttatttcacaaggtgggacggcgttgctaggaaacatgatggct
gtcggcttaatcttatcgatgcggtaccattataagagttatatgttctctgatgaagaa
aaagaattttag

DBGET integrated database retrieval system