KEGG   Carnobacterium maltaromaticum: BN424_954Help
Entry
BN424_954         CDS       T02342                                 

Gene name
metQ2
Definition
(GenBank) NLPA lipofamily protein
  KO
K02073  D-methionine transport system substrate-binding protein
Organism
cml  Carnobacterium maltaromaticum
Pathway
cml02010  ABC transporters
Module
cml_M00238  D-Methionine transport system
Brite
KEGG Orthology (KO) [BR:cml00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BN424_954 (metQ2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cml02000]
    BN424_954 (metQ2)
Transporters [BR:cml02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   D-Methionine transporter [MD:M00238] [OT]
    BN424_954 (metQ2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lipoprotein_9 DUF5478 Myco_arth_vir_N ETRAMP LPAM_2
Motif
Other DBs
NCBI-ProteinID: CCO10418
UniProt: K8EF57
Position
1005682..1006515
Genome map
AA seq 277 aa AA seqDB search
MKKTRIFGLIVALVLVVTLAACGSNGAKEDKKAKDNVLKIGASNIPHAVILEHVKPILEK
EGIDLQITTYQDYILPNKALADGEIDANYFQHIPYFNLQVKENDYDFVNAGAIHIEPLGL
YSKRVKNLDDLKDGATVIVSNSTTDWGRVISILQDAGLVKVKDGVDITTASFDDIVENKK
NLKFTYEADPALMTTFLNNDEGDIVAINSNFAVDNGLDPLKDAIALEKTSSPYANIVAVR
KEDKDNENIKKLVEVLKSKDVKEWILKEWNGAVVPVD
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaacaagaatttttggattaattgtggctttagttttagtagtaacgttagcg
gcttgtgggtcaaatggtgctaaagaggataaaaaagctaaagataacgtattgaaaatt
ggagcaagtaatatcccacatgcagttattttagaacatgtgaagccaatcttagaaaaa
gaaggaattgatttacaaataaccacttatcaagactacattttgcctaacaaagcctta
gctgatggtgaaattgatgcaaactatttccaacatattccttatttcaatttacaagtg
aaagaaaatgactatgattttgtaaatgcaggggcaattcacattgaaccactgggtttg
tattctaaacgcgttaaaaacttagacgacttaaaagacggagcaacagtaattgtcagt
aattcaacaaccgactggggccgtgttatcagcattttacaagatgcaggcttagttaaa
gtcaaagatggtgttgacataactacagcatcgtttgacgacatcgttgaaaataaaaag
aatttaaaattcacatatgaagcagatccagcattgatgacgaccttcttgaacaatgat
gaaggggatattgtggcaattaactcaaactttgccgttgataatggcttagatcctttg
aaagatgcgattgctttagaaaaaacaagttcaccatatgcgaatattgtagcagttcga
aaagaagataaagacaatgaaaatattaaaaaattagttgaagtcttaaaatcaaaagat
gtaaaagaatggattttaaaagaatggaacggcgcagtcgtaccagtagactaa

DBGET integrated database retrieval system