KEGG   Carnobacterium maltaromaticum: BN424_958Help
Entry
BN424_958         CDS       T02342                                 

Definition
(GenBank) putative uncharacterized protein
  KO
K08234  glyoxylase I family protein
Organism
cml  Carnobacterium maltaromaticum
Brite
KEGG Orthology (KO) [BR:cml00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99985 Amino acid metabolism
    BN424_958
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyoxalase Glyoxalase_4 Glyoxalase_3 Glyoxalase_2
Motif
Other DBs
NCBI-ProteinID: CCO10422
UniProt: K8E2S5
Position
1009298..1009678
Genome map
AA seq 126 aa AA seqDB search
MNLQALHHVAIIVSDYQKSKEFYVDLLGFEVIRENYRPERNDHKLDLKFGNSELEIFAMP
NNPKRVSNPEACGLRHLAFKVDAIEEVISELAAKGIDCEPIRIDDYTNEKMTFFFDPDGL
PLELHE
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgaatttacaagcactacatcatgtggcgattattgtctcagattatcaaaagtcaaaa
gaattttatgttgatttactaggctttgaagtgatcagagagaactaccgtcctgaacgg
aatgatcataaattagatttaaaatttggcaacagcgagcttgaaattttcgcaatgcca
aataatcccaaacgagtttcaaatccagaagcatgtggacttagacatttagcttttaaa
gtcgatgctattgaggaagtcatttctgaattagctgctaaaggaattgactgtgagccg
attcggatcgatgattacacgaatgagaagatgaccttctttttcgatccagatggtttg
ccactagaattacatgaataa

DBGET integrated database retrieval system