KEGG   Carnobacterium maltaromaticum: BN424_970Help
Entry
BN424_970         CDS       T02342                                 

Definition
(GenBank) helix-turn-helix family protein
Organism
cml  Carnobacterium maltaromaticum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_3 HTH_19 HTH_31 HTH_26 HTH_25 Memo YdaS_antitoxin HTH_11 MerR_1 Sigma70_r4
Motif
Other DBs
NCBI-ProteinID: CCO10434
UniProt: K8E301
Position
1019612..1020331
Genome map
AA seq 239 aa AA seqDB search
MGIHLKIREERKIKGMTQEQLAEKIGVSTKIIVQWENEKYTPSLENLKRLRTEFGITLDY
LLKDNIELKSRYDNYVKLGKNVLELVDEEYPLEFIQNYYICSREPSLLIPRKLAVEFINE
VGERIKNVEPSNSKEIKSIQKDMKHFLFFWYKYNKGKYLLSKELKIKMLTMNSASFNTEE
IAKYLQDSICLKKPMLLLRNLMISRLIEECKLFDYELDNEITEELDFTGEIMWPIETYK
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgggaatacatttaaaaataagagaagaacgaaaaattaaaggtatgactcaagaacaa
ttagctgaaaaaataggtgtttcaacaaaaataattgtgcagtgggagaacgaaaaatat
acgccatcattggaaaatttaaaaagattaagaacagagtttgggattactttagactat
cttttaaaggataatattgaattaaagagtagatatgataattatgtgaaattggggaaa
aatgttcttgaattggtagatgaagaatacccgcttgagtttatccaaaattattatata
tgttccagagaacctagcttgttaattcctagaaagttggcagtggagtttattaatgag
gttggtgaaagaattaagaatgttgaaccttcaaatagtaaagagataaaatctattcaa
aaagatatgaagcattttttatttttttggtataagtataataaaggtaaatacttactc
tcaaaggaattgaagattaaaatgttgactatgaatagtgcttctttcaatactgaagaa
atcgcaaagtacttacaagattctatatgtttgaaaaagccaatgctacttttaagaaac
ttgatgataagtagattaatagaagaatgtaagttgtttgattatgaattagacaatgaa
ataactgaagaattggattttactggtgagattatgtggccaatagaaacttataaataa

DBGET integrated database retrieval system