KEGG   Chlamydia muridarum Nigg3 clone G0.1.1: NC80_01135Help
Entry
NC80_01135        CDS       T03404                                 

Definition
(GenBank) tRNA(Ile)-lysidine synthetase
  KO
K04075  tRNA(Ile)-lysidine synthase [EC:6.3.4.19]
Organism
cmm  Chlamydia muridarum Nigg3 clone G0.1.1
Brite
KEGG Orthology (KO) [BR:cmm00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cmm03016]
    NC80_01135
Enzymes [BR:cmm01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.19  tRNAIle-lysidine synthase
     NC80_01135
Transfer RNA biogenesis [BR:cmm03016]
 Prokaryotic type
  tRNA modification factors
   Other tRNA modification factors
    NC80_01135
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP_bind_3 QueC PAPS_reduct tRNA_Me_trans ThiI
Motif
Other DBs
NCBI-ProteinID: AIT90441
UniProt: A0A069ZYE4
Position
267921..268886
Genome map
AA seq 321 aa AA seqDB search
MVIRLFENDKQLEVFFSSLDKKKKYLLALSGGSDSLLLMYLLRSRGISFTAVHVDYGWRE
TSYQEACDLASLCEREQIPFILDRQEVANPMDFSDIENIARQYRYELFYRLCKERLFAGV
FLGHHADDQAETILKRVFEGAHLGNLKGMARYGTYKGITLLRPLLHITKRQIVEALDNYR
IEYVQDATNADERFLRARMREQLFPYLQEIFGKNIRQPLLFLAEDSAELREYLDQQAAPF
LSQVIDNEIGQFLPVGQELLQTAFLTKWVCKQFFFKQGLVASKGFLQTVYDHLVRRSEAR
LRLRNRTVLVKARGVIIESIY
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atggtaatccgtttattcgagaatgataagcaattagaagtttttttttcttctttagac
aagaaaaaaaaatacttgctggcgttatccggcgggagtgattccttattattaatgtat
ttgctgaggtctcgaggcatttctttcacggctgtacatgtggattatggctggagggag
acttcatatcaggaagcttgtgatttggcttccttatgcgagcgggaacaaattcctttt
attttagatcgccaggaagtcgcaaatcctatggattttagtgacatcgagaatattgct
cggcaataccgttacgagttattttatcgattgtgtaaagaacgacttttcgcaggtgtg
tttctagggcatcatgcagatgatcaagcagaaaccattttgaaacgggtatttgaagga
gctcatcttggaaatctcaagggaatggcacggtatggaacatataagggcataacatta
ctgcgaccgcttctacatattactaagaggcaaattgttgaagctcttgataattatcga
attgagtatgttcaggatgccacaaatgctgatgaacgctttttacgtgcaagaatgagg
gaacaattattcccttatctacaagagattttcgggaaaaatatcagacagcctttgctt
tttcttgcggaagattctgcagagctcagagagtacttagatcagcaagcagcacctttt
ttatcgcaggttattgataatgagataggacaatttctacctgtgggacaagagttatta
caaacggcctttttgacaaagtgggtatgtaagcagtttttcttcaagcaggggcttgtc
gcttcaaagggttttttgcaaacggtttatgatcatctcgtgcgaagatctgaggcaaga
ttacgacttcgtaatcgaaccgtattggtaaaagctaggggagtaatcatagaaagtata
tattga

DBGET integrated database retrieval system