KEGG   Chlamydia muridarum Nigg3 clone G0.1.1: NC80_01505Help
Entry
NC80_01505        CDS       T03404                                 

Definition
(GenBank) ATPase AAA
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
cmm  Chlamydia muridarum Nigg3 clone G0.1.1
Pathway
cmm03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:cmm00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    NC80_01505
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cmm03400]
    NC80_01505
Enzymes [BR:cmm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     NC80_01505
DNA repair and recombination proteins [BR:cmm03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     NC80_01505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 HHH_4 SH3_13 UvrD_C_2 Viral_helicase1 AAA_11 Helicase_RecD HHH_5 PhoH T2SSE UvrD-helicase AAA_22 AAA_12 DUF2075 AAA_16 RsgA_GTPase HHH AAA_28 AAA ABC_tran AAA_29 Mg_chelatase Terminase_6
Motif
Other DBs
NCBI-ProteinID: AIT90505
UniProt: A0A069ZW51
Position
complement(358652..360886)
Genome map
AA seq 744 aa AA seqDB search
MGCEEKLSGTLELILPEDSLSNQMGYAFLRVPYKNSLVTICGNSSLSLFKIGASVDLTGY
WSVDASGALVFRFTTAKTYSPSLGIIAYLTSQIKGVGPKLAQKIIATFGEETLSVLDSCP
SKLVEVDGISLARCEDFSRQLHEQKDLRNALLFLQRHGIAIHYGLRLYKKYQNQTIDKVC
QDPFLLAKEMYGVGFKTADLIASCLGVPLNSPNRIVAGIQYSLDELQEEGHTCYPLNDFI
VLVEKLLNEDTPEKIVRKEEILTQVHFLSRQKAVYIKELEQDSYIWSRQLFLAEQQIAID
IRRLLFSSKRIQPINTQEAILEVENLLDLKLEDKQKEALYASSSQKIHIISGGPGTGKST
ITRAILSIFEKISSPQKIILAAPTGKAAKRMTEITGKRTQTIHSLLQYDFKTLSFRKNHE
DPIDCDLVIIDESGMIDTILLQRFLAALPDHAILILIGDVHQLPSVGPGNVLKDLILSNH
IEVTYLTKIFRQLQNSNIITNAHKVNQGEFPVLNSSSGKKDFLFFQKEDPEEAIKHIIHL
VSDFVPKKFGIFMKDIQVLAPMKKGVLGIFNLNKELKAALNPNKPFIQGKFHSFSTGDRV
MQTRNNYNKEVFNGDIGYIASIDFAKKSLVACVDGRYICYSQTELNDLTPAYATSIHKYQ
GSEASCVILPIHTSHYVMLYRNLLYTAITRGKKLVILVGTKKAIAIAVRNDKVQHRCTGL
QQSVQTLLNKPIPLFSPTYTICKP
NT seq 2235 nt NT seq  +upstreamnt  +downstreamnt
atgggttgcgaagagaaactttccggtactttggaacttattcttccagaagattcccta
tccaatcaaatgggatatgctttcctacgagtcccttacaaaaattcattagtgaccatt
tgtggaaattcctctctttctctctttaaaattggagcttctgttgatttaacaggttat
tggagtgtggacgctagcggagctttagtttttcgctttactacagccaaaacgtacagt
ccttctttgggaatcatagcctaccttacttcccaaatcaaaggcgtgggtcccaaactt
gctcagaaaattatagcaacctttggagaagaaactctttctgtgcttgattcatgtccc
tccaaacttgtagaagtagatggaatctctcttgcccgctgtgaggatttttctaggcaa
ctccacgagcaaaaagacctacgtaatgccctactatttctgcaacgacatggaattgct
attcactatggcttacgtctatataaaaaataccaaaaccaaactattgataaagtctgt
caagatccttttcttcttgcaaaggaaatgtatggtgtagggtttaaaactgcagatctc
attgcctcatgtcttggagtcccactgaattctcctaatcgtatcgttgcaggaattcaa
tactctttagatgaactgcaagaagaaggccatacgtgctatccccttaatgatttcatt
gttctcgttgaaaaactactgaacgaagatactcctgaaaaaattgtacgtaaggaagaa
atccttactcaagtgcattttctgtctcgacaaaaagctgtttatatcaaagaactagaa
caggactcttatatctggtctagacagctttttcttgccgaacaacaaatcgctatagac
atccgaagacttttattttcttcgaaacgcatccagcctatcaatacccaagaggcaatt
cttgaagtagaaaatcttctggatttaaagctggaagacaagcaaaaagaagctctctat
gctagttcttcccaaaaaatccacatcatatctgggggaccaggaactgggaaaagtaca
attacacgggctattctctcaatctttgaaaaaatctcgtctccccaaaaaatcatcctt
gcagctcccactggaaaagctgcaaaacgcatgacggaaatcacagggaaacgtacccaa
acaatccattccttacttcaatatgattttaagactttgtcatttcgtaaaaatcatgaa
gatcctattgattgcgatctcgttattattgatgaatcaggaatgatcgatacgattctc
cttcaaagattccttgctgcattacctgatcatgctattcttatcctaattggagatgtg
caccagctacctagcgtaggcccaggcaatgtccttaaagacctcattctttcaaaccat
attgaggtaacctacttaaccaagatcttccgtcagttacaaaattccaatatcattact
aatgctcacaaagtaaaccagggggaattccccgtccttaacagctcttctggaaaaaaa
gactttttattctttcaaaaagaagatccagaagaggctataaagcatattatccatctt
gtttctgatttcgttccgaaaaaattcggcatctttatgaaagacattcaagtccttgct
cctatgaaaaaaggagtactagggattttcaatctgaataaagaattgaaagctgctctc
aaccccaataaaccatttatccaagggaagtttcactccttctctacgggagatcgcgtt
atgcaaacgcgaaataactataataaagaagttttcaatggagatattgggtacatcgcc
tctatagattttgctaaaaaaagtttagtagcttgtgttgatggccgatatatttgttat
tcacaaacggaactaaacgacttaacaccagcttatgctacttccatacataagtatcag
ggaagtgaggcctcatgcgtgattctacctatccatacctctcattatgttatgctgtat
agaaacctcctctatacagcaatcacgagagggaaaaaactggttattctagtaggaact
aaaaaagctattgctatcgctgtacgcaatgataaagtacaacatcgatgcactggacta
caacaatctgtacaaactctccttaataagcctattccgcttttctctcccacatacacg
atttgcaaaccttag

DBGET integrated database retrieval system