KEGG   Cucumis melo (muskmelon): 103485676Help
Entry
103485676         CDS       T03195                                 

Definition
(RefSeq) wall-associated receptor kinase 2-like
Organism
cmo  Cucumis melo (muskmelon)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase GUB_WAK_bind EGF_CA cEGF WAK Kinase-like Adeno_E3_CR2 PIP49_C EGF_3
Motif
Other DBs
NCBI-GeneID: 103485676
NCBI-ProteinID: XP_008441596
UniProt: A0A1S3B3B1
Position
Un
AA seq 764 aa AA seqDB search
MGRPTETLIRLTAVKIIVILSAAFVVASATTNATVTVASQALPGCDEWCGDVRIPYPFGM
REGCYLNNETFLLQCLSPAGSPNSLMPVLGPNIITNISIITGEIKLLNRVAQACHPPDTA
TDVFPDMVVGIPNYTISHTKNKFVVIGCDTFAIVSGNVVDGQSFQSGCLALCDNIGTVKD
GACSGSGCCQLDLPSGLDSMVFEVASLTNHTNVSSFNPCGYAFVTERDSFDFSSKYIRNF
PEKIVPVVLDWAISNDTCVTAKNKTNCVCGKNSTKVDLLDDPSRYRCQCLDGFEGNPYLP
DGCQDIDECKDDNLNDCRFECVNTIGSYTCNCPEDFKGDGKRQGDGCTRNSKSFVQIIVG
VTVGFTVLVIGSAWLYLGYKKWKFLKLKEKFFEKNGGLMLQQHLSQWQASTDHMVRIFTK
EDLDKATNKYDDSAVVGKGGFGTVYKGVLDDGSVVAIKKSKLVDQSQTDQFINEVIVLSQ
INHRNVVKLLGCCLETEVPLLVYEFISNGTLYEYVHDKTNDRNSLSWEARLRIAAETAGV
ISYLHSSASTPIIHRDIKTTNILLDHNYTAKVSDFGASKLVPMDQTQLSTMVQGTLGYLD
PEYLLTSELTEKSDVYSFGIVLLELITGKKAVSFEGPEAERNLAMYVMCAMKENRLEEVV
EKGMATKANIEQIKEAAKLATTCLRIKGEERPSMKEVATDLEGLRGLNEANEKLESKGET
MVGIWVQSDGALESTSKQFSASGSTNIVDDSMKVHILPLIHNGR
NT seq 2295 nt NT seq  +upstreamnt  +downstreamnt
atgggacgtccaaccgagacgctcattcgactcacagcggtgaaaataatagtcatctta
tcagcggcttttgtagtcgcatcggccacgacgaacgcaaccgtgaccgtagcttcccaa
gccttacccggctgcgacgaatggtgcggcgacgtgcggattccttatccgttcgggatg
agggaagggtgttatctaaataatgaaacattcttacttcaatgtcttagcccagctggt
agcccaaattctctaatgccagttctaggccccaatatcattacaaatatatccattatc
acgggggagattaaactgttgaacagggtggcgcaagcttgccaccctccagatactgct
accgatgtttttcccgatatggttgttggtatacctaactacactatttcccataccaaa
aacaagttcgtcgtgataggctgcgatacattcgctattgtttcagggaatgtcgtagat
gggcaatcctttcaatctggatgtttggcattgtgtgataacattggcacggtaaaagat
ggggcttgctctggtagtgggtgttgtcagctggatcttcctagtgggcttgattctatg
gtgttcgaggtcgccagtttaacgaatcacactaatgtgtcgagtttcaatccttgtggg
tatgcgtttgtaacagaacgagatagcttcgacttctcttcaaagtatattcgaaatttt
cctgaaaaaatagttccggtagtgcttgattgggccattagtaatgatacttgtgtgacg
gctaagaacaaaactaattgtgtttgtggcaaaaatagcaccaaggttgacttacttgat
gatccatctagatatcgttgccagtgcctggatggctttgaggggaatccatatctcccc
gatggttgtcaagatatagatgagtgcaaggacgacaatcttaatgactgcaggtttgag
tgtgttaatacaataggaagctatacttgcaattgcccagaagactttaaaggagatgga
aaacgtcaaggagatggttgcactcgaaactccaagtctttcgttcaaatcatcgttgga
gttactgtgggcttcacagttttagtaattgggagtgcatggttatacttgggttacaaa
aagtggaagttccttaaactgaaggagaagttttttgagaaaaatggtggtttgatgctt
caacaacatctttctcaatggcaagcatccactgatcatatggttagaattttcactaaa
gaggatttggacaaggctacaaacaagtacgacgacagtgcagtggttggaaaaggtggc
tttggtactgtttacaaaggagtgttagacgatggttccgtagttgcaatcaagaaatca
aaattagtagaccaatctcaaactgaccaattcatcaacgaagtcattgttctgtcccaa
atcaaccaccgtaatgtggtcaagctcttgggatgctgtctagagacagaagttccattg
ttggtgtacgagttcatcagcaatggtacgctttatgaatacgtccatgataaaacaaat
gaccgcaattctctttcgtgggaagctcgtttgagaatagctgcagaaactgctggggtg
atttcatatttgcattcttcagcttccactccaattatccatagagatatcaagacaact
aacattcttttagaccataattacactgcaaaggtatctgatttcggtgcttccaagttg
gttccgatggatcaaactcagttgtcaacaatggtgcaagggactctcggatatttagac
cctgaatacttattaaccagcgagttgacagagaagagcgatgtgtatagttttggaata
gtgcttctagagcttataacagggaagaaggcagtgagtttcgaagggccagaagcggag
aggaacctagccatgtacgtgatgtgtgcaatgaaggaaaatcgtttggaagaagttgtg
gaaaagggaatggcgacaaaagcgaacattgagcagataaaagaagccgcaaagttagca
acaacgtgtttaagaataaagggggaggagcggcctagcatgaaggaggtggctacggat
ttggaagggttgagagggttgaatgaggctaatgagaaattagagagcaaaggagagaca
atggtaggtatttgggtgcaatccgatggagctttagaatccacatccaagcagtttagt
gcgagtgggagtacaaatattgtggatgatagtatgaaggttcacattttgcctctgatt
cacaatggaagatga

DBGET integrated database retrieval system