KEGG   Cucumis melo (muskmelon): 103486279Help
Entry
103486279         CDS       T03195                                 

Definition
(RefSeq) acyl-coenzyme A oxidase 4, peroxisomal
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
cmo  Cucumis melo (muskmelon)
Pathway
cmo00071  Fatty acid degradation
cmo00410  beta-Alanine metabolism
cmo00592  alpha-Linolenic acid metabolism
cmo00640  Propanoate metabolism
cmo01040  Biosynthesis of unsaturated fatty acids
cmo01100  Metabolic pathways
cmo01110  Biosynthesis of secondary metabolites
cmo01200  Carbon metabolism
cmo01212  Fatty acid metabolism
cmo04146  Peroxisome
Module
cmo_M00087  beta-Oxidation
cmo_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:cmo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    103486279
  09103 Lipid metabolism
   00071 Fatty acid degradation
    103486279
   00592 alpha-Linolenic acid metabolism
    103486279
   01040 Biosynthesis of unsaturated fatty acids
    103486279
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    103486279
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    103486279
Enzymes [BR:cmo01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     103486279
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acyl-CoA_dh_N Acyl-CoA_dh_1 Acyl-CoA_dh_M Acyl-CoA_dh_2
Motif
Other DBs
NCBI-GeneID: 103486279
NCBI-ProteinID: XP_008442401
UniProt: A0A1S3B696
Position
Un
AA seq 440 aa AA seqDB search
MTVDAKVNRQDDKDKNARSAYFGLPALDVSVAFPQATSASSFPPSVSDFYQFNDLLTPEE
QALRKKVRQCVEKEVAPIMTKYWEKAEFPFEVVPKLGSLCIAGGTIKGYGCPGLSITGSA
VAVAEVARVDASCSTFILVHSSLAMLTIALCGSEEQKHKYLPSLAKFDTVACWALTEPEN
GSDASGLRTTATKVEGGWVIEGKKRWIGNSTFADVLVIFARNTITNEINGFIIKKNAPGL
TVTKIENKIGLRIVQNGDIVMNKVFVPDEDRLPGVNSFKDTNKVLAVSRVMVAWQPIGIA
MGVYDMCHRYLKEREQFGAPLAAFQLNQQKLVLMLGNVQAMFLIGWRLCKLYEKGTMTPG
QASLGKAWITLRARETVSLGRELLGGNGILSDFLVAKAFCDLEPIYTYEGTYDINTLVTG
REITGVASFKPAALAKRSRL
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgacggttgacgccaaagtgaatcgccaagatgataaggacaagaatgcaagaagtgcc
tacttcggtttaccggcgctggatgtttctgttgcattccctcaagccacgtctgcatcc
tcctttcctccttccgtctcagacttctatcagttcaacgacctattgactcctgaggag
caagctctcagaaaaaaagtgagacagtgcgtggaaaaagaagtagctccaattatgaca
aagtattgggagaaggcagagtttccatttgaagttgtcccaaagcttggtagcttgtgc
attgctggtggtactatcaagggttatgggtgtcctggtctgtctattactggaagtgct
gttgctgttgctgaagtagcaagagttgatgcaagttgttccactttcattctggtgcat
tcatcgctcgcaatgctcaccatcgctctatgtggatcggaggagcaaaagcataaatat
ttaccttccttggcaaagtttgataccgtcgcatgttgggctttgactgagcctgaaaat
ggaagtgatgccagtggtttaagaacaacggcaacaaaggttgaaggaggttgggtaata
gaggggaaaaaacgctggataggaaacagcacattcgctgatgtattggttatttttgcc
aggaatacaattacaaatgaaataaacggatttataataaaaaaaaatgcccctggtctg
acggttacaaagatagaaaataaaattggtttgcggatcgttcaaaatggagacattgta
atgaataaagttttcgtaccggatgaagataggttacctggtgtaaattctttcaaggat
acaaacaaggttcttgccgtttcgcgtgtaatggttgcctggcaacccattggcatagca
atgggggtttatgacatgtgtcacagatatttgaaggagagggaacaatttggagcacca
ttagccgcttttcagcttaaccaacagaaacttgttctcatgctgggaaatgttcaagca
atgttcctcattggttggcgactttgcaaattatatgaaaagggaacaatgactccaggt
caagctagcttgggaaaggcatggatcactctgagagctagggaaaccgtttctctagga
cgtgagttgcttggaggcaatgggattttatcagactttctagttgcaaaggcattctgt
gatttggaaccaatatatacgtatgaaggtacgtacgacatcaacacattggttactggg
agagaaataactggtgttgccagtttcaagcctgctgctctagccaaaagaagccgccta
tga

DBGET integrated database retrieval system