KEGG   Cucumis melo (muskmelon): 103486309Help
Entry
103486309         CDS       T03195                                 

Definition
(RefSeq) lactosylceramide 4-alpha-galactosyltransferase
  KO
K01988  lactosylceramide 4-alpha-galactosyltransferase [EC:2.4.1.228]
Organism
cmo  Cucumis melo (muskmelon)
Pathway
cmo00601  Glycosphingolipid biosynthesis - lacto and neolacto series
cmo00603  Glycosphingolipid biosynthesis - globo and isoglobo series
cmo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cmo00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    103486309
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    103486309
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:cmo01003]
    103486309
Enzymes [BR:cmo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.228  lactosylceramide 4-alpha-galactosyltransferase
     103486309
Glycosyltransferases [BR:cmo01003]
 Glycan extension
  P blood group
   103486309
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gb3_synth Gly_transf_sug Caps_synth TcdA_TcdB
Motif
Other DBs
NCBI-GeneID: 103486309
NCBI-ProteinID: XP_016899682
UniProt: A0A1S4DUL6
Position
Un
AA seq 414 aa AA seqDB search
MSERCAISPILPTILLAAIIFLICGDGIIYKVSIRTVSLDEKRNSNSTITCITQLQIKQT
LVGEPRQSSPENRDEDDSETFDSLVVPSNLSAKDARVDWFRNHLPNFRILQSNNLTQQFH
NRLLEFLSHECEVQFFMTWVSPARSFRERELMAAESVFKSHPRGCLTIISRTLDSERGCK
ILKPLLDHGFKIQAIAPDLPLLFRNTPVEAWFDEMKSGKKDPGQIPLAQNLSNLMRLAVL
YKYGGVYIDTDFIVLKSFMGLKNSIGAQSIDPVTKNWTILNNAVLVFDKKHPLLEKFMEN
FASNFDGSRWGYNGPFLVTRVIAKVTGARASPGFNVTVLPPAAFYPVDWIKIGELFKKPE
NRAVESWAKARLAQLDNETYGIHLWNKQSKSYVIQKGSVIERLFSDHCIICSYT
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaaggtgtgctatatcacccatactgccaaccatcttgcttgctgccatcatc
ttccttatatgtggagatggcataatctacaaagtttcgattcgaacagtatctctagat
gagaaaagaaattcaaactcaacaattacgtgcataacacagttgcagattaagcaaacg
ttagttggagagccaaggcagtcctcaccagaaaacagagacgaagatgatagtgaaact
tttgattccttagtagttccatccaatctttcagcaaaagatgcgagagttgattggttt
aggaaccaccttcccaactttcgaattttgcagtcaaacaacttgacgcagcagtttcat
aatcgacttctggagttcctcagccatgagtgtgaggtacaattcttcatgacatgggta
tctccagcaaggtctttcagagaaagagaattaatggcagcagaaagtgtttttaagtct
cacccccgtggatgcttaactattatatcaagaacgctggactcagaaagaggctgcaag
attcttaaacctctacttgatcatgggtttaaaattcaggcaatcgcaccggacttgcct
ttgctattcagaaacaccccggttgaggcttggtttgatgagatgaagagtggaaaaaaa
gacccaggtcagattccattagctcagaatctatctaacctgatgagacttgcagtttta
tacaaatatggaggtgtttacatagatacagactttatagttttgaagtctttcatgggg
ttgaagaactcaattggcgcacaaagtattgatccggtaactaagaactggacaatactg
aataacgctgttcttgtttttgataagaagcatccacttctagagaaatttatggaaaac
tttgcatcaaattttgatggtagcagatggggatataatggaccttttctggtcaccaga
gtaatagcaaaggtaacaggagccagagcaagccccggtttcaacgtcactgtactgcca
ccagcagcgttctacccagtagactggattaagattggtgaacttttcaagaagccagaa
aaccgggctgttgaaagttgggcaaaagcaagactagctcagctagataatgagacctat
ggaatacacctatggaacaagcagagtaagagttatgtgattcaaaagggaagcgtcata
gaacgattattctctgatcattgcatcatttgcagctatacttag

DBGET integrated database retrieval system