KEGG   Cucumis melo (muskmelon): 103486569
Entry
103486569         CDS       T03195                                 

Definition
(RefSeq) delta(14)-sterol reductase
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
cmo  Cucumis melo (muskmelon)
Pathway
cmo00100  Steroid biosynthesis
cmo01100  Metabolic pathways
cmo01110  Biosynthesis of secondary metabolites
Module
cmo_M00917  Phytosterol biosynthesis, squalene 2,3-epoxide => campesterol/sitosterol
Brite
KEGG Orthology (KO) [BR:cmo00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    103486569
Enzymes [BR:cmo01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     103486569
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295
Other DBs
NCBI-GeneID: 103486569
NCBI-ProteinID: XP_008442795
UniProt: A0A1S3B6J9
Position
Un
AA seq 369 aa
MDLGFLFQASIPSWEAVAILFIFFFYLAIAGSVLPGRVIPGVILSDRTRLQYRCNGLLSL
LVLVALLGVGVKMNYISPTAISDRGLELLSATFWFSVLATFLLCVAGYSSSSQSASLKPH
ITGNFIHDWWFGIQLNPHFLGIDLKFFFVRAGMMGWLLINLSVLARSVLNATLSQSMILY
QTFCAIYVLDYFVHEEYMTSTWDIIAERLGFMLVFGDLVWIPFTFSIQGWWLLTNKAELT
TAATIANCLIFXLGYLVFRGSNKQKHMFKKNNKALIWGKPPKVVGGKLLASGYWGIARHC
NYLGDLLLALSFSLPCGISSPIPYFYPMYLLILLIWRERRDEARCAEKYKDIWAEYTKLV
PWRILPYVY
NT seq 1110 nt   +upstreamnt  +downstreamnt
atggatctgggttttctttttcaagcttcaattccctcttgggaagctgtggctatcctc
ttcatcttcttcttttacttggccattgctggatctgttctacctggcagagttattcct
ggagtgattttgtcagaccgtactaggcttcaatatcgctgcaatggtctactgtctctt
ctggtgctcgttgcccttcttggggttggtgttaagatgaattacatttctcccactgct
atttcagatagaggactggagctgctatctgcaaccttctggtttagtgtcctggcaaca
tttttactatgtgttgctggctacagctcaagtagtcaaagtgcttctctaaagcctcat
atcacaggaaattttattcatgattggtggtttggtatacagttgaatccccactttttg
ggcattgacctcaaatttttctttgtgagagctggaatgatgggttggctacttattaat
ctatcagttcttgctagaagtgttttgaacgccaccttgagccagtcgatgatcctctac
cagacattttgtgcgatatatgtcctggactacttcgttcacgaggagtacatgacctcc
acatgggacataattgctgagagattaggattcatgttggtatttggagatcttgtttgg
attccttttacctttagcattcagggttggtggcttttgacaaacaaggcggagctaaca
acagctgctaccattgctaattgcttaattttttaattgggatatcttgtgtttagagga
tctaacaagcaaaaacacatgtttaaaaagaacaacaaagcgcttatatggggtaagcct
ccgaaagttgttggaggaaagttgcttgcttctggttattggggaattgctcgccactgt
aattaccttggagacttgttgcttgcactttctttcagcttgccatgtgggataagctcc
ccaattccatacttttatcccatgtatcttctcattctgctaatatggagagagagacga
gatgaagctcgttgtgctgagaaatacaaagacatttgggcggagtacaccaaactcgtc
ccttggagaatattgccttatgtttattag

DBGET integrated database retrieval system