KEGG   Cucumis melo (muskmelon): 103487298Help
Entry
103487298         CDS       T03195                                 

Definition
(RefSeq) probable low-specificity L-threonine aldolase 1
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
cmo  Cucumis melo (muskmelon)
Pathway
cmo00260  Glycine, serine and threonine metabolism
cmo01100  Metabolic pathways
cmo01110  Biosynthesis of secondary metabolites
cmo01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cmo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    103487298
Enzymes [BR:cmo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     103487298
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 DegT_DnrJ_EryC1 Pyridoxal_deC Aminotran_5 Cys_Met_Meta_PP OKR_DC_1
Motif
Other DBs
NCBI-GeneID: 103487298
NCBI-ProteinID: XP_016899824
UniProt: A0A1S4DV13
Position
Un
AA seq 360 aa AA seqDB search
MVSNRKIDLRSDTVTKPTETMRAAMAMAEVDDDVLGNDPIALELEEEMAKIMGKEEGLFV
PSGTMGNLISVLVHCEIRGSEVIVGDNSHIHIYENGGIATIGGVHSRTVKNKDDGTMDID
LIEAAIRNPKGQLFFPTTRLICLENTHANSGGRCLCVEYIDKVGELAKKHDLKLHIDGAR
IFNASVATDVSVDRLVQVADSVSVCLSKGLGAPVGSVIVGSKSFISKARRVRKTLGGGMR
QIGILCAAGLVALKENVQKLEADHHKAKQLASGLCQIKGIKVDLKSVETNIIFFEIEEDS
QISAKLLCKSMEEHGILLMQESLSRIRIVLHHQISTSDVEYTLKCMKQFLCGVPALQNGN
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atggtgagtaatagaaagattgatctacgttctgacacggtgacaaaaccgaccgagaca
atgcgagctgcaatggcgatggccgaggtagacgatgatgtgttgggtaatgacccaatt
gccctcgagttagaagaagagatggcaaagataatgggaaaagaagaagggttatttgta
ccatcaggcacgatggggaatctaataagtgttcttgtgcattgtgaaattagagggagt
gaagtgattgttggagataattctcatattcatatatatgaaaatggaggaattgcaact
attggaggagtccattcaagaacagttaagaacaaagatgatggaacaatggacattgat
ttgattgaagctgccattagaaatccaaagggacagctattcttcccaacaacaaggctc
atttgtttagagaatactcatgcaaatagcggtggaagatgcctttgtgtagaatatatt
gacaaagttggggagttagctaagaaacatgatttgaaacttcacatcgacggagcccgt
attttcaatgcctccgtggctacggatgtttcagttgatcgattggtacaagttgctgac
tcagtatcggtatgcttgtcaaaaggtctaggcgcaccggttggttccgttattgttggt
tccaaaagctttatttctaaggctagaagggttagaaaaacattgggtggaggaatgagg
caaattggcatcctttgtgcagctggacttgtagctcttaaagagaatgttcaaaaactt
gaagctgatcatcacaaagccaagcaactagctagtggattgtgccaaattaaaggaata
aaggtggatctaaaatcagttgagacaaatattatattttttgaaattgaagaggactcc
caaatctcagcaaagttattgtgtaaaagcatggaggagcatggaattcttttgatgcaa
gaaagcttatcaaggattagaatcgttcttcatcatcagatatcaacgagtgatgtggag
tacactttgaagtgcatgaagcaatttctctgtggggttccagcacttcaaaatggcaac
taa

DBGET integrated database retrieval system