KEGG   Cucumis melo (muskmelon): 103487762Help
Entry
103487762         CDS       T03195                                 

Definition
(RefSeq) probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH4
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
cmo  Cucumis melo (muskmelon)
Pathway
cmo03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:cmo00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    103487762
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:cmo03041]
    103487762
Enzymes [BR:cmo01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     103487762
Spliceosome [BR:cmo03041]
 Complex C
  Other components
   Step II factors
    103487762
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HA2 OB_NTP_bind Helicase_C DEAD AAA_22 AAA_30 ABC_tran DUF2075 AAA_19 SRP54 AAA_29 T2SSE Helicase_RecD ATPase_2 AAA_16 AAA_23 MMR_HSR1 PhoH FtsK_SpoIIIE RsgA_GTPase AAA_33 AAA_24
Motif
Other DBs
NCBI-GeneID: 103487762
NCBI-ProteinID: XP_008444435
UniProt: A0A1S3BAD9
Position
Un
AA seq 701 aa AA seqDB search
MAQLPILQFEEKIIETVERNQVVVIIGETGSGKSTQLSQMLYRRGYTKSGIIGVTQPRRV
AAVSVARRVAEELGVQLGEEVGYAIRFEDRTSERTRIKYLTDGVLLRESLSDPELGQYSV
IILDEAHERSLNTDTLMGLMKRLIRMRNSHLKVLITSATLDGDKVSKFFFDCPVLTVPGK
LYPVEILYSNERPKSYIESCLKTAIDIHTKEPEGDVLIFLTGQDDIEKLVSKLEEKVYSL
EEGSCMDAIILPLHGSLPPELQVRVFSCPPPNCRRFIAATNIAETSLTVDGVVYVIDSGY
VKQRQYNPSTGMYSLDVVQISKVQANQRAGRAGRTRPGKCYRMYTSMDYQEELLDVTVPE
IQRSSLAGSVLYLKSLDLPDIDILKFDFLDPPTSESLEDALKQLYLIDAIDENGSITRIG
QTMAELPLEPSLSRTLIEANEYGCISQALTVVAMLSAETTLLPGHRKNADKKRKHRSLNL
PDGSGWGDHIQLLQIFELWDQKNYDVNWCKDHDLQVRGMLFVKDVRKQLCQIMQKIAKGS
LDVWSFRNQKESQAEYWNLRKALCVGYANQLAERMIHHNGYRTLSFKPQVVQVHPSSVMK
PDEDGKFADYVVYHELITTSRPYMRNVCAVQVDWVMPILNKVKNLNVNKLSGGSADLTSG
TIEGIKNSPKKEDANTKLTLDGHENKILAARERFLARRGKK
NT seq 2106 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagctcccaattctccaattcgaggagaaaatcatcgagacagtggagcggaat
caagtggtagtcataattggagagacaggctcagggaagagtactcagctctctcaaatg
ctctaccggagaggatacacaaagtctggtattatcggcgttactcagcctcgccgtgtt
gccgccgtttctgttgctcgacgagttgctgaggagctgggggttcagcttggtgaggaa
gtaggatatgccattcgttttgaggacagaacctcggaaagaactcgaatcaaatatctc
actgatggagtccttctccgcgaaagtctttctgatcctgagcttggtcaatattcagtt
atcattttggacgaggctcatgagagaagtttaaatacagacacattgatggggttgatg
aaacgtttaattagaatgcgtaattcccacttgaaggttcttatcacttcagcaaccctt
gacggggacaaagtatcaaagttcttttttgattgccctgtgttgacagttcctggaaag
ttgtatcctgttgagatattgtatagcaatgaacgtccaaagagctacattgaatcatgt
ctaaaaacagctattgatatacacaccaaagaaccagaaggggatgttctcattttcttg
actggacaggatgatatagagaagttagtatcaaagctggaggaaaaagtttatagcctg
gaagaaggatcttgcatggatgctataattcttcctcttcatggttcattgccaccagaa
ctgcaggtgcgggtattcagttgtccacctccaaattgtaggagatttattgcagcaacc
aatattgctgaaacttctttgactgttgatggtgttgtgtatgtcattgattctggttat
gtcaagcaacggcaatacaacccatcaactggcatgtactccctcgatgttgtacaaatt
agcaaagtgcaagcaaatcaacgtgccgggcgagctggaagaacacgtccggggaagtgc
tacaggatgtacacttccatggactatcaagaggagttattggatgtaacagttcctgag
atccaacgatcttctcttgctggtagcgttctttatttgaaatcattggaccttccagat
atagatattctcaaatttgattttcttgatccaccaacttccgaatctttagaagatgca
ttgaagcaactatatcttattgatgctattgatgaaaatggatctattactagaattggg
caaacaatggctgagcttccattagaaccttcactctcacgaaccttgatagaggcaaat
gagtatggctgcatatcccaggctttgactgttgttgcaatgttatctgccgaaacaacc
ttgcttcctggtcacagaaagaatgctgataagaagaggaagcacaggtccttgaacctt
cctgatggctcaggatggggtgaccacatccaattgctacagatttttgagctctgggat
caaaagaattatgatgttaattggtgcaaagaccatgatttgcaggtaagagggatgttg
tttgtcaaagatgtacggaaacaactgtgtcaaataatgcagaaaatagccaaaggatca
ttggacgtatggtcattcagaaaccaaaaggagagtcaagcagaatactggaatttgagg
aaggctttatgtgtaggttatgccaatcaacttgcagagagaatgattcatcacaatggc
tatcgaactcttagttttaagccccaagtcgttcaggtgcatccctcgtctgttatgaag
ccagatgaagacgggaaatttgccgactatgttgtgtaccatgagctcattacaacatct
cgaccttatatgcgcaacgtctgtgcagtacaggttgattgggtaatgccgatattaaac
aaggttaagaatctaaatgtaaacaaattaagtggtggcagtgctgatcttacgagtggg
acaatagagggcattaaaaactctccaaagaaagaggatgctaacactaaattgactctt
gatggccatgaaaacaaaattctagctgctcgagaacggtttcttgcacggagagggaag
aagtga

DBGET integrated database retrieval system