KEGG   Cucumis melo (muskmelon): 103487780Help
Entry
103487780         CDS       T03195                                 

Definition
(RefSeq) beta-fructofuranosidase, insoluble isoenzyme CWINV3-like
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
cmo  Cucumis melo (muskmelon)
Pathway
cmo00052  Galactose metabolism
cmo00500  Starch and sucrose metabolism
cmo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cmo00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    103487780
   00500 Starch and sucrose metabolism
    103487780
Enzymes [BR:cmo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     103487780
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-GeneID: 103487780
NCBI-ProteinID: XP_008444460
UniProt: A0A1S3BB78
Position
Un
AA seq 580 aa AA seqDB search
MDKMPPKRLEMGKYGLVASFILLLASNRMGFVVSHEYANEVHSTPQQVQRTSYHFQPLKN
WMNDPNGPMFYKGIYHFFYQHNPNGAVFNSKMVWAHSISYDLINWVHLNHALEPTDPFDI
NGCWSGSVSFLPKNKPRILYTGIDSSFQQVQNLAIPTNYSDPFLEKWRKSPQNPIIAPPD
GAERNRFRDPTTAWQGPDGEWRVAIGGQTSYGGAAMLYRSEDFVRWHQFRFPLYSSQDSG
TWECPDFYPVMLNGTNGIGFSSGFGVGVKHVMKASFNSRDHYTLGSYVPEKEKFTSDHGL
GFDFRGINLGLRYDYGKFYASKTFYDSSQKRRILWGWVNESDSRQDDINKGWSGLQAIPR
KIWLSKTGRQLIQWPVKEIKMLRRNHFSLHHKELRGRSTMEVLGGSASQVDVEVSFALPH
LEEAESVDTRWGVLDPQVLCSKRDASMNGRVGPFGLLVLASNDLSEHTAIYFHVLKAHNR
YVVLMCSDESRSSFRKGVDKTTYGAFVDIDPRYKKISLRTLVDHSIVESFGGKGKTCITS
RVYPTLAVNNDARLYAFNNGTQTVVISSLKVWNMSNAEIK
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atggataaaatgccacctaagaggttggaaatgggcaagtatggtttggttgcatcattt
atccttttgcttgcaagcaatagaatgggatttgtggtttctcatgaatatgccaatgaa
gttcatagtactccacaacaagttcagaggacatcttatcacttccaacccctcaaaaat
tggatgaatgacccaaatgggccaatgttctacaagggaatttaccactttttctatcaa
cacaatcccaatggagctgttttcaatagcaaaatggtgtgggctcattcaatatcatac
gatctaatcaattgggtccatttgaatcatgcccttgagcccactgatccattcgatatc
aatggctgctggtccggctcagtctccttccttcccaagaacaaaccccgcattctctac
acaggaattgattccagtttccagcaggttcaaaatttagcaatacccaccaattattcg
gacccttttcttgaaaagtggagaaaatccccccaaaatccaattatcgctcctcccgat
ggggcggagagaaacagatttagagacccaactacagcttggcagggcccagatggagaa
tggagggtcgccattggagggcagacgagctatggaggagcagcgatgctttacagaagc
gaggacttcgttcgctggcatcaattcaggtttcctctttattcttctcaagattctgga
acttgggaatgtcctgatttttaccctgtgatgcttaatggaacgaatgggattggtttc
tctagtggatttggggttggtgttaagcatgtgatgaaagctagctttaactctcgtgat
cattatacattgggaagttatgtccctgagaaagagaagttcacttctgatcatggtctt
gggtttgattttagaggaataaacttagggttgaggtatgattatgggaagttttatgct
tccaagacgttttatgatagttcccaaaagaggaggatattgtggggttgggttaatgaa
tctgatagcagacaagatgatatcaataagggatggtccggacttcaggcgattcctcga
aagatttggctatccaagactggaaggcagttgatacaatggccggtcaaggaaattaag
atgttacgcaggaaccattttagcttgcatcataaagaacttagagggagatcaacaatg
gaagttcttggtggctcagcttcccaggttgacgtggaggtttcctttgcgcttccccac
ttagaggaggccgagtcagtggacacaagatggggtgttcttgatcctcaagtgctgtgt
agtaaaagagatgcatcaatgaatggcagagttggaccctttggcttgttggttttggcc
tccaatgacttatccgaacacactgcaatatattttcatgttctcaaagctcataacaga
tatgtagtgcttatgtgcagtgatgaaagcaggtcttctttcagaaagggggtagataaa
accacttatggggcgttcgtagacatagacccacgctacaaaaagatatcattgagaaca
ctggtagaccactctatagtcgagagctttggaggaaaaggaaaaacatgcatcacatcc
cgagtatatccgactttggctgtcaataacgatgctcgtttatatgcattcaacaatgga
actcaaactgtagtgatttccagtttgaaggtttggaacatgtcaaatgctgaaatcaaa
tga

DBGET integrated database retrieval system