KEGG   Cucumis melo (muskmelon): 103489635Help
Entry
103489635         CDS       T03195                                 

Definition
(RefSeq) guanine nucleotide exchange factor SPIKE 1
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
cmo  Cucumis melo (muskmelon)
Brite
KEGG Orthology (KO) [BR:cmo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cmo04131]
    103489635
Membrane trafficking [BR:cmo04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    103489635
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2 DOCK-C2
Motif
Other DBs
NCBI-GeneID: 103489635
NCBI-ProteinID: XP_008447100
UniProt: A0A1S3BGL5
Position
Un
AA seq 1836 aa AA seqDB search
MHLLHRRDSTPASIKWHNKFEENLEQWPYLNELVQCYSTDWVKDENKYGHYETIGPVSFQ
NQIYEGPDTDIETEMRLTYARRTKPDDTTEDDVPSTSGRPESTTYDPLLSNVPKQIGPSP
LPAYEPAFDWENERSMTFGQRIPETPATHGLKISVKVLSLSLQAGLVEPFYGTICLYNRE
RREKLSEDFHFRIAPKEMQDPKISFEPRGIFYLEAPSASVCLFIQLEKHATEEGGVTASV
YSRKEPVHLNEREKQKLQVWSQIMPYRESFAWAIVSLFDNSTGAASAGSASPSSPLAPSI
TGSSSHEGVFEPSTKVTVDGKLGYSSGSSVVVEISNLNKVKEGYTEDALQDPKHKVHKPV
KGVLRLEIEKHQISHADNENMSESGSVISDSVDMVDRLVDSTFKKFPNNGSDSQHLSCSS
KSNFPVGKEFSGNGSLSHENVDTNADDFHAFDFRVMMRNEPFLQLFHCLYVYPLTVSLSR
KRNLFIRVELREDDSDPRRQPLEAMYPVEVGASLQKWAHTQVAVGARVACYHDEIKLSLP
ATWTPKHHLLFTFFNIDMQAKLEAPKPVPIGYASLPLSTHAQLRSEISLPVMRELVPHYL
QDTNRERLDYLEDGKNIFKLRLRLCSSLYPINERIRDFFLEYDRHTLRTSPPWGSELLEA
INSLKNVDSTALLQFLHPILNMLLHLIGNGGETLQVAAFRAMVNIVTRVQQESAEDGERN
HFLVNYVDYAFDDFGGRQPPVYPGLSTVWGSLARSKAKGYRVGPVYDDVLAMAWFFLELI
VKSMALEKTRLFYHSLPLGEDIPPMQLKEGVFRCIMQLYDCLLTEVHERCKKGLSLAKRL
NSSLAFFCYDLLSIIEPRQVFDLVSLYLDKFSGVCQSVLHDCKLTFLQIICDHDLFVEMP
GRDPSDRNYLSSVLIQELFLTWDHDDLPLRAKAARILVVLLCKHEFDARYQKPEDKLYIA
QLYFPLIGQILDEMPVFYNLNATEKREVLIVILQIVRNLDDTSLVKAWQQSIARTRLFFK
LMEECLVLFEHRKPADGVLMGSSSRSPAAVGDGPGSPKYSDRLSPAINNYLSEASRQEFR
PQGTPDNGYLWQRVNSQLSSPNQPYSLREALAQAQSSRIGASAQALRESLHPVLRQKLEL
WEENLSAAVSLQVLEITEKFSSMASSHSIATDYGKLDCITSIFMSFFSKNQPLAFYKALF
PVFNSVFDLHGATLMARENDRFLKQVTFHLLRLAVFRNDSIRKRAVTGLQILVRSSFCHF
MQTARLRVMLIITLSELMSDVQVTQMKANGTLEESGEAQRLRKSLEDMADESKSSSLLNE
CGLPENALVIIPEASADNRWSWSELKYLSDSLLLALDASLEHALLASVMSMDRYAAAEGF
YKLATAFAPVPDLHIMWLLHLCDAHQEMQSWAEAAQCAVAVAAVVMQALVARNDGVWSRD
HVTALRRICPMVSSEITSEASAAEVEGYGASKLTVDSAVKYLQLANKLFSQAELYHFCAS
ILELVIPVYKSRRSYGQLAKCHTLLTNIYESILEQESSPIPFTDATYYRVGFYGEKFGKL
DRKEYVYREPRDVRLGDIMEKLSHVYESRMDGSHTLHIIPDSRQVKAEELQPGVCYLQIT
AVDPVIEDEDLGSRRERIISLSTGSVRARVFDRFLFDTPFTKNGRTQGGLEDQWKRRTVL
QTEGSFPALVNRLLVTKSESLEFSPVENAIGMIETRTAALRNELEEPRSSEGDQLPRLQS
LQRILQGSVAVQVNSGVLSVCTAFLSGEPATRLRSQELQQLIAALLEFMAVCKRAIRVHF
RLIGEEDQEFHTQLVNGFQSLTAELSHYIPAILSEL
NT seq 5511 nt NT seq  +upstreamnt  +downstreamnt
atgcatcttctacatcgtcgagattccactcccgcctctatcaagtggcacaacaagttc
gaggagaatttggagcaatggccatacctcaatgagctcgtgcagtgctattccactgac
tgggtaaaggatgaaaataagtacggtcactatgagactatcggtcccgtctcctttcag
aatcagatatatgaaggccccgatactgacattgaaactgaaatgcgtcttacttatgct
agacgcacaaagcctgatgatactacagaggatgatgtacctagtacctccggaaggcca
gagtctaccacatatgatccattgttatcgaatgttccaaagcagattggtccttctcct
cttccagcttacgagccagcttttgattgggaaaatgaaaggtcaatgacatttggtcag
aggataccagaaactcctgcaacacatggcttgaagatttctgttaaagttctatcacta
tcccttcaagcggggttggttgagccattttatggtacaatttgcttgtataatagggag
aggagggaaaaattatctgaggatttccattttcgcattgcacctaaagaaatgcaggat
cctaaaatatcatttgaaccgcgcggaattttctatttggaggctccatcagcatctgtc
tgtcttttcattcagttagagaaacatgccacagaagaaggaggggttactgcttctgtg
tattcacgtaaagaaccagtgcatttgaatgaaagagaaaagcaaaaattgcaggtctgg
tctcaaatcatgccttacagagaatcctttgcctgggccattgtttcattatttgacaac
agcactggtgcagcatctgctggatctgcttccccaagtagtcctcttgctcctagcata
actggctctagttcccatgaaggcgtctttgagcctagcaccaaggtcacagtagatgga
aagctgggttactctagtggaagctctgtagttgttgaaatatccaacttaaataaggtt
aaggaaggctacacggaagatgcacttcaggatcccaaacacaaggttcataagcccgta
aaaggagttcttaggctggaaattgagaagcaccagatttcccatgctgacaatgaaaac
atgtcagagagtggcagtgtgatcagtgactccgtcgatatggtggacagattggttgat
tccacattcaagaagttccccaataatggttctgatagccagcatcttagttgcagctca
aagtcaaattttcctgtcgggaaagaattttctggaaatggatcattatctcatgaaaat
gtcgatacaaatgcagatgacttccacgcattcgacttccgcgttatgatgaggaacgag
ccattcttgcagctctttcactgtctttatgtttatcccctgactgttagtttgagccgc
aagaggaacttgttcattcgagtagaacttagagaggatgatagtgacccacgcagacag
cctctggaggctatgtatccagtggaggtgggtgcatctcttcagaagtgggctcacact
caagttgctgtaggtgcaagagtggcttgctaccatgatgagattaaactctccctcccg
gctacctggacaccaaagcatcacttgttgtttactttcttcaatattgatatgcaagca
aaactagaagctcccaagccagtgccgattggatatgcatcactccccttgtcaacacat
gctcagttacggtctgaaatttctttgccagtaatgagagagcttgttccacattacctc
caagatacaaacagggagaggctagattacttggaagatgggaagaacatcttcaaattg
cgcttaagactgtgttcctccctttatcccatcaacgaacgaatcagggacttttttctg
gaatacgataggcacactcttcgaacaagtcctccttggggttctgaacttctggaggct
attaacagtttaaagaatgttgattccactgcgttactccaattccttcatcctattttg
aatatgttgctccatctcattggcaacggcggagaaaccctccaggttgcggcttttaga
gcaatggttaatattgttactagggtgcagcaggaatcggccgaagatggtgaaagaaat
cacttccttgttaattatgttgattatgcttttgatgactttggaggtcgccagccaccc
gtataccctggtctgtccactgtctggggaagcttggctaggagcaaggccaaaggctat
cgtgttggaccagtttatgatgatgttttggctatggcctggtttttccttgagctaatt
gtcaaatcaatggcactggagaaaactcgacttttctatcatagccttccattaggtgaa
gatattcctccaatgcaattgaaagaaggtgtatttagatgcataatgcagttgtatgat
tgccttcttaccgaagtacatgaacgttgcaagaagggattaagcttggctaaacgttta
aatagcagtttagcgttcttttgttatgatcttctatccattattgagcctcgccaagta
tttgatttggtgtccttgtacctggacaagttttcaggtgtctgccaatcagttctgcat
gactgcaagcttacatttttgcagattatatgtgatcacgacctctttgttgaaatgcct
ggaagagacccttctgataggaactacctttcatctgtattaatacaagaactttttctt
acttgggatcatgatgatttacctctgcgggcaaaggcagccagaattttagttgttctc
ttatgcaagcatgaatttgatgcccggtaccagaagcctgaagataaactatacattgct
cagctgtactttccacttatcgggcagattttagatgaaatgcctgtcttctataaccta
aacgccacagagaagcgtgaagttttgattgtgattttgcaaattgtgcgcaacttagat
gatacttctcttgtcaaggcatggcaacaaagcattgctcgaaccagattgttcttcaag
ctcatggaagaatgccttgttctttttgagcatagaaaacctgctgatggcgtgcttatg
ggatccagttctcggagccctgctgctgttggagatggtcctggttccccgaaatattct
gacagactttctcctgcaatcaacaactacctatctgaggcatcaagacaagaattcaga
cctcagggaacgcctgataatggttatttgtggcaaagggtgaattctcagttgagctcc
ccaaatcagccatattccttgagagaggcactagctcaggcacaatcttctaggattggt
gcatctgcacaagcattaagggagtcgctgcacccggtattaagacaaaaattggaactt
tgggaagaaaacttaagtgcagctgtaagtcttcaagttttggaaataacagagaagttt
tcctcgatggcatcatctcatagcattgccactgactacgggaaacttgattgcatcacc
tccatattcatgagcttcttctctaagaatcaacctttggcattctacaaggccttattt
cctgtctttaacagtgtctttgatcttcatggcgcaactttaatggcaagagaaaatgac
cgtttcttaaagcaagtaacattccatcttcttcggcttgcagttttccgaaatgatagc
ataaggaaaagggcagttacaggacttcagatacttgtgaggagttctttctgtcacttt
atgcagacggctagattgagggtcatgcttataattactttgtcagagttgatgtctgat
gtgcaagtaacgcagatgaaggcaaatgggacacttgaagagagtggtgaagcacagcgt
ctacgaaaatccttagaagacatggcagatgaatcaaagagctccagtctgttgaatgaa
tgtggacttcctgagaatgctctcgtcataattccagaagcttccgctgataataggtgg
tcctggtcagagttgaaatatctttctgacagtctccttctggctcttgatgctagtcta
gagcatgctcttttagcctctgtgatgtcaatggatagatatgctgctgcagaaggtttc
tacaaacttgcaacggcatttgcccctgtgcctgatcttcatattatgtggttattgcat
ttatgcgatgcgcatcaagagatgcagtcatgggcagaggctgcacagtgtgctgtggcc
gttgcagctgtggtcatgcaggctcttgtcgctcgaaatgatggtgtctggagcagagat
catgtgacagctctacgcagaatatgtcctatggttagcagtgagatcacatcagaagca
tcagcagctgaggtggagggatacggtgcctctaaactcacagtcgactctgctgtgaag
tacctacagcttgcgaacaagcttttctcccaagctgagttgtatcatttttgtgctagt
attctggagcttgtaattccagtttataaaagtaggagatcatatggacaactggcgaaa
tgtcacactttactaacaaatatttacgaatcgatccttgagcaggaatcaagcccaatc
ccatttactgatgcaacatattacagagtgggattctatggtgaaaaatttgggaagctg
gacaggaaggaatacgtatatcgtgaaccccgtgacgtacggttgggtgacataatggag
aaactcagtcatgtatacgagtctagaatggatggcagtcacacactgcatattattcca
gactctaggcaagtgaaggcggaggagttgcagccgggagtttgctacctacagataacg
gcagttgatcctgttattgaagatgaagatctgggaagtagaagagagagaatcatttcg
ttatctaccgggagtgtccgtgctcgtgtatttgaccgcttcttatttgacaccccattt
accaaaaatggaagaactcaaggtgggctagaagaccaatggaagaggaggactgttcta
cagactgagggatccttcccggccttggtaaatagactcttagtaactaagtccgaatcg
ctcgagttctcccctgtggaaaatgcaatcggaatgatcgaaactagaactgctgctctg
cggaatgaactggaagagcctcgcagttctgagggcgaccaacttccacgactccagagt
cttcagagaatactccaaggcagcgtcgcagttcaagttaacagtggagtcttgagcgtg
tgcactgcattcttgtctggtgagccggctacaaggttgcggtcgcaagagttgcagcaa
ctcattgctgcacttctcgaatttatggctgtatgtaagcgtgctattcgagttcatttt
agattaattggagaggaagaccaggagttccacacccaactagtgaatggatttcagtct
ctcaccgccgaactatcgcattacattcccgctattctatccgaattgtaa

DBGET integrated database retrieval system