KEGG   Cucumis melo (muskmelon): 103490108Help
Entry
103490108         CDS       T03195                                 

Definition
(RefSeq) heat shock cognate 70 kDa protein 2
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
cmo  Cucumis melo (muskmelon)
Pathway
cmo03040  Spliceosome
cmo04141  Protein processing in endoplasmic reticulum
cmo04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:cmo00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    103490108
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    103490108
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    103490108
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cmo01009]
    103490108
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:cmo03041]
    103490108
   03009 Ribosome biogenesis [BR:cmo03009]
    103490108
   03110 Chaperones and folding catalysts [BR:cmo03110]
    103490108
   04131 Membrane trafficking [BR:cmo04131]
    103490108
   03051 Proteasome [BR:cmo03051]
    103490108
   03029 Mitochondrial biogenesis [BR:cmo03029]
    103490108
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cmo04147]
    103490108
Protein phosphatases and associated proteins [BR:cmo01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     103490108
Spliceosome [BR:cmo03041]
 Complex B
  Other components
   Prp19 complex
    103490108
 Complex C
   Prp19-CDC5 complex
    103490108
Ribosome biogenesis [BR:cmo03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    103490108
Chaperones and folding catalysts [BR:cmo03110]
 Heat shock proteins
  HSP70 / DNAK
   103490108
Membrane trafficking [BR:cmo04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    103490108
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    103490108
Proteasome [BR:cmo03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    103490108
Mitochondrial biogenesis [BR:cmo03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    103490108
Exosome [BR:cmo04147]
 Exosomal proteins
  Proteins found in most exosomes
   103490108
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C Hydantoinase_A
Motif
Other DBs
NCBI-GeneID: 103490108
NCBI-ProteinID: XP_008447699
UniProt: A0A1S3BIM2
Position
Un
AA seq 647 aa AA seqDB search
MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
QVAMNPINTVFDAKRLIGRRFSDSSVQSDIKLWPFKVIPGPGDKPMIVVNYKGEEKQFAA
EEISSMVLIKMREIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD
NRLVNHFVQEFKRKHKKDISGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLYEGIDFY
STITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQDFF
NGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLI
PRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQI
TVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKK
KVEAKNALENYAYNMRNTVNDEKIGAKLSPADKKKIDDAIEQSIQWLDANQLAEADEFED
KMKELESICNPIIAKMYQGAGADMGGGADDSAPSGGSGAGPKIEEVD
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atggccggcaagggagaaggtccggctatcggtattgatctcggaaccacttactcttgt
gttggtgtttggcagcacgatcgtgttgagatcattgccaatgaccagggtaacaggact
actccttcctatgttgccttcaccgatactgagcgtttgattggtgatgctgctaagaac
caggtcgccatgaacccgattaacaccgtctttgacgcgaagaggttgatcggtagaaga
ttcagcgactcttcagtccaaagtgacatcaagttgtggccattcaaggtcatccctgga
ccaggtgacaagcccatgatcgttgttaactacaagggtgaagagaagcagttcgctgct
gaagaaatctcttccatggttcttattaagatgcgtgaaattgccgaagcttacctcggt
tccacagtgaagaacgccgttgtcactgttcctgcttacttcaacgactcccaacgtcaa
gccaccaaggatgctggtgtcattgctggtctcaacgtcatgagaattatcaatgaaccc
accgctgccgccattgcctacggtcttgacaagaaggcaacaagtgtcggtgaaaagaat
gtcttgatcttcgatcttggtggtggtacttttgatgtctctcttctcaccattgaagag
ggtatcttcgaggtgaaggccactgctggagacactcatcttggtggtgaagattttgac
aacagacttgtcaaccactttgttcaagaattcaagaggaagcacaagaaggacatcagt
ggcaaccccagagctcttagaaggctgagaacttcttgtgagagagccaagagaactctc
tcatccactgctcagaccaccattgagattgattctttgtatgaaggaattgacttttac
tccaccattactcgtgctagattcgaggaattgaacatggatcttttcagaaagtgtatg
gaacccgtcgagaagtgtttgagagatgctaagatggacaagagcactgttcatgatgtt
gtacttgttggtggttcgactagaattcccaaggtccaacagttgttgcaagacttcttc
aatggcaaggaactttgcaagagcattaaccccgatgaagccgttgcctacggtgctgct
gtacaagctgccatcttgagcggtgaaggcaatgagaaggtgcaggatcttcttctattg
gatgtcacccctctttcacttggtttggaaaccgccggtggagtcatgactgttttgatc
ccaagaaacaccacaattcccacgaagaaggaacaagtcttctctacctactccgacaat
cagcccggtgtgttgatccaagtatacgaaggtgaaaggacaagaacacgcgacaacaac
ttgcttggaaaattcgaactttccggtatccctccagctcccaggggtgttccacaaatc
acagtgtgctttgatatcgacgccaacggtatcttgaacgtctctgccgaagacaagacc
accggtcaaaagaacaaaatcaccattactaacgacaagggaagactctccaaggaggag
attgagaagatggttcaagaggcagagaagtacaagtctgaagatgaggagcacaagaag
aaggttgaagcaaagaatgccttggagaactacgcttacaacatgaggaacacagtgaac
gacgagaagattggtgctaagctttccccggccgacaagaagaagatcgacgatgccatc
gagcagtccatacaatggctggacgccaaccagctcgctgaggccgacgaattcgaggac
aagatgaaggagttggagagcatttgcaacccaatcatcgccaagatgtaccaaggtgca
ggagctgatatgggcggcggtgcagacgacagtgctccttccggcggtagcggtgctgga
cccaagattgaggaagtcgactaa

DBGET integrated database retrieval system