KEGG   Cucumis melo (muskmelon): 103491518Help
Entry
103491518         CDS       T03195                                 

Definition
(RefSeq) aldehyde dehydrogenase family 3 member F1-like
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
cmo  Cucumis melo (muskmelon)
Pathway
cmo00010  Glycolysis / Gluconeogenesis
cmo00053  Ascorbate and aldarate metabolism
cmo00071  Fatty acid degradation
cmo00280  Valine, leucine and isoleucine degradation
cmo00310  Lysine degradation
cmo00330  Arginine and proline metabolism
cmo00340  Histidine metabolism
cmo00380  Tryptophan metabolism
cmo00410  beta-Alanine metabolism
cmo00561  Glycerolipid metabolism
cmo00620  Pyruvate metabolism
cmo00903  Limonene and pinene degradation
cmo01100  Metabolic pathways
cmo01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cmo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    103491518
   00053 Ascorbate and aldarate metabolism
    103491518
   00620 Pyruvate metabolism
    103491518
  09103 Lipid metabolism
   00071 Fatty acid degradation
    103491518
   00561 Glycerolipid metabolism
    103491518
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    103491518
   00310 Lysine degradation
    103491518
   00330 Arginine and proline metabolism
    103491518
   00340 Histidine metabolism
    103491518
   00380 Tryptophan metabolism
    103491518
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    103491518
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    103491518
Enzymes [BR:cmo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     103491518
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh DIM1 DNTTIP1_dimer
Motif
Other DBs
NCBI-GeneID: 103491518
NCBI-ProteinID: XP_008449722
UniProt: A0A1S3BMP6
Position
Un
AA seq 481 aa AA seqDB search
MENLEVKLEETREYYNSGKTKEASWRFSQLKGLHKFLNQNQQQIYNALFQDLGKHHVEAF
RDEIGNLQMSLNFALENLKHWMSPKKAKLPAIAVLNSAEVVPEPLGVVLVISSWNFPFGL
SLEPLIGAIAAGNCVFLKTSEFSPASSAFLAKVIGDYVDKKAVRVVEGGAATGERLLQLR
WEKIFFTGSERVGRIVMAAAVKHLTPVTLELGGKCPAIVDSLSCSWDIESTAQRIVVGKF
GACAGQACIAIDYILVEHKFISTLVELLKKYIKKFFDKGSNEAKNMARIVNKQNFLRLKN
MVDEPAVQATIIYGGSMDEDKLFVEPTILLNPPNDAEIMREEIFGPILPIIGMDKIEDSI
DFINSRAKPLAIYAFTKDKAFQRRLVSETTSGSLTFNDAIIQYAVDTLPFGGVGESGIGR
YHGKFSFDTFSHEKAVVKRSFLIDFWFRYPPWNNHKLELLRHAYNFNYFQLVLTVLGLKR
S
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atggagaatttggaggtgaagttagaggaaacaagagaatattacaatagtggaaaaaca
aaggaagcatcttggagattttcacaacttaaaggtttacacaaatttcttaaccaaaat
caacaacaaatttacaatgcccttttccaagatttggggaaacaccatgttgaagctttt
agagatgagatcggtaatctacaaatgtccctcaattttgctttggagaatttgaaacat
tggatgtcccccaaaaaggcgaagttgccggcgattgctgtgttgaattcagcagaagtg
gttcccgagcctttgggggttgttcttgtgatctcatcttggaactttccgtttgggttg
tcgttggagccattgataggggcaatagcagctggaaattgtgtgtttttgaagacgtcg
gagttttctccggcgagttcagcttttctggcgaaagtgatcggagattatgttgataag
aaagcagtgagagtggttgaaggaggggcagcgaccggagagcggctgctgcagctgcgg
tgggagaagattttctttacaggaagtgaaagagtggggcggattgttatggcggccgcc
gtgaaacacctaacgccggtgactttggagctcggagggaaatgccccgccattgtcgac
tcactttcatgttcatgggatattgagtctactgctcaacggatcgttgtcggaaaattt
ggagcctgcgccggtcaagcttgcatagcaattgattatatccttgttgaacacaaattt
atatccaccttggtcgaattgctgaagaagtacatcaagaaattcttcgataaaggttcg
aacgaagcgaaaaacatggcgagaatcgtaaacaaacaaaactttttgagattgaagaat
atggtggatgaacctgctgtccaagctacaatcatttatggaggatccatggacgaggac
aaattgttcgttgagccgactattctgttgaacccaccaaacgatgcagaaattatgaga
gaagaaatctttggaccaatccttcccataattggaatggataagattgaagacagtata
gatttcatcaattcaagggctaagcctcttgccatttatgccttcacaaaagacaaagct
ttccaaagaagactcgtctcagaaactacgtccggcagcttgacatttaatgatgcaatt
attcagtatgcagtggatacactcccgtttggaggggttggtgaaagtgggattggcaga
taccatggaaaattctcattcgacacctttagtcatgaaaaggcagttgtgaaaaggagc
ttcttgatcgacttctggttcagatatccgccctggaacaatcacaagcttgagctgctt
agacatgcttataattttaactattttcagttagttctcactgttttgggtctgaagagg
tcttaa

DBGET integrated database retrieval system