KEGG   Cucumis melo (muskmelon): 103491710Help
Entry
103491710         CDS       T03195                                 

Definition
(RefSeq) histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH4
  KO
K11420  euchromatic histone-lysine N-methyltransferase [EC:2.1.1.43]
Organism
cmo  Cucumis melo (muskmelon)
Pathway
cmo00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:cmo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    103491710
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cmo03036]
    103491710
Enzymes [BR:cmo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     103491710
Chromosome and associated proteins [BR:cmo03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     103491710
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SAD_SRA SET Pre-SET BRF1
Motif
Other DBs
NCBI-GeneID: 103491710
NCBI-ProteinID: XP_008449992
UniProt: A0A1S3BN95
Position
Un
AA seq 721 aa AA seqDB search
MVVKSRVLRSAANGELHSPVTPEEKPKRSKVAAPGGKSAKAAAPEGDAEQPSPSPMRRTS
ARIIKLKAEKELLVRQRVELLDEPGSRSKRKKTNSQVKSKRNTPNVKDEVREDKGEVVED
KAVVVPVSKDVTKFEDGDASKPMEVCAPEKRTGDDAGPGNMVEKSDHVKVKETLRLFNKY
YLHFVQEEEKRCKKAEVAQKAPKQSKSKKKAPVEDTKNKSKRPDLKAISKMLETNEILNH
EKRIGNVPGINIGHRFYSRAEMVAVGFHSHWLNGIDYMGLSYSKMYSNYSFPLAVAIVLS
GMYEDDLDNAEDVIYTGQGGQNLTGNKRQIRDQKMERGNLALKNCIEQGVPVRVVRGHES
ATSYCGKLYTYDGLYKVIQYWAEKGISGFTVFKFRLRRIEGQSLLTTNQVQFIYGRVPKS
VSEIRGLVCEDIAGGQEDIPIPATNLVDDPPVAPIGFTYCKFIKVARGVKLPPNANGCDC
KESCITSRTCSCAKLNGSDFPYVQRDGGRLIEAKDVVYECGPNCGCGVGCVNRTSQRGIK
YRLEVFRTPKKGWAVRSWDFIPSGAPVCEYTGILARTEDLDHVSENNYIFDIDCLQTIRG
IGGRERRSRDASLPANNSLDVVDDRRSESVPEFCIDACSTGNIARFINHSCEPNLFVQCV
LSSHHDIKLARVVLFAAENIPPLQELTYDYGYALDSVYGPDGKIKQMPCFCGATECRKRL
F
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
atggttgtcaagtcccgggtactacgttctgctgccaatggagagctgcattctccagta
actcccgaggagaagccgaaacgctctaaagtagccgcgcctgggggaaagagtgctaaa
gctgccgcaccggagggagatgcggaacagccatctccttctcctatgaggaggactagt
gctcgaatcataaagctgaaggctgagaaggagcttctagtgcgtcaaagagtagagctc
cttgatgaacccggcagtcgcagcaaaaggaagaagacgaacagtcaggtaaaaagtaag
cgtaatactccaaatgtgaaggatgaggtgagggaagataagggcgaagtggtggaagat
aaggccgttgttgttccggtatccaaagacgtcactaaatttgaagacggtgatgcgagc
aaacctatggaagtgtgcgcgccagaaaagaggactggggacgatgctggtccgggtaat
atggttgagaagagtgaccatgtcaaggtgaaggagactctcaggttgttcaataagtac
tatcttcattttgtacaggaagaggaaaagaggtgcaaaaaagctgaagtagctcaaaaa
gctcccaaacagtcaaaatctaagaagaaggcccctgtagaagacacaaaaaacaagtcg
aagcgaccagatttgaaggcaatttctaagatgttggagacaaatgaaattttgaaccat
gagaaaagaattggcaacgttccaggtatcaatattgggcatcgattctattcacgggct
gaaatggtagctgttggatttcacagccactggctgaatggaattgattacatggggttg
tcatacagcaaaatgtacagtaattactccttcccacttgcggtggccatagttttatcg
ggcatgtatgaggatgatttggataatgctgaggatgtcatttacactggtcaaggagga
caaaatttaactggcaataaacgtcagatccgggatcaaaaaatggaacgtggtaatttg
gctctcaagaattgtattgagcaaggtgtcccagtgagagtggttcgggggcatgaatct
gccactagttactgtgggaaactctacacatatgatggcttgtataaggttatacagtat
tgggcagaaaaaggtatttctggatttactgtgtttaaatttcgtcttaggcgtattgaa
ggacagtcgttgttgactacaaaccaggttcaatttatatatggtcgggttcccaagtca
gtttcagaaatacgtgggttggtgtgtgaggatatcgctgggggtcaggaggatattcct
attccagcaactaatttggttgacgatccacctgttgcacccataggtttcacttattgt
aaattcattaaagttgcacgtggtgtgaaacttcctccgaatgctaatggatgcgactgt
aaagaatcatgtatcacttcaaggacatgttcatgtgctaagcttaatggatcagacttc
ccatatgtgcaacgtgatggtggaagacttatagaagccaaggatgtggtttacgaatgt
ggtcccaattgtggttgtggtgttggttgtgtgaatcgaacttctcagagggggatcaaa
tatcgacttgaggttttccgaacaccaaagaaagggtgggctgttaggtcttgggatttt
ataccttctggcgcacctgtttgtgaatacacaggaatacttgcaaggacagaggatctt
gatcatgtatcagagaataattatatcttcgacattgattgtttgcaaacaattaggggc
atcggtggacgagagaggcgctcaagagatgcatccttgccagcaaacaattctttggat
gttgtagatgatcgaagatccgaaagtgtgccagagttttgcattgatgcttgttccact
ggaaatattgccaggtttatcaatcatagttgcgaacctaatctttttgtccaatgtgta
ttgagctcacaccatgacatcaaacttgctcgagtggtactatttgctgcagaaaacata
ccacctctccaggaactgacatacgactatgggtatgcacttgatagcgtgtatggtcca
gatgggaagataaaacagatgccatgcttctgtggtgcaactgagtgtaggaaacgcttg
ttttag

DBGET integrated database retrieval system