KEGG   Cucumis melo (muskmelon): 103493390Help
Entry
103493390         CDS       T03195                                 

Definition
(RefSeq) (+)-gamma-cadinene synthase-like
  KO
K15803  (-)-germacrene D synthase [EC:4.2.3.75]
Organism
cmo  Cucumis melo (muskmelon)
Pathway
cmo00909  Sesquiterpenoid and triterpenoid biosynthesis
Brite
KEGG Orthology (KO) [BR:cmo00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00909 Sesquiterpenoid and triterpenoid biosynthesis
    103493390
Enzymes [BR:cmo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.75  (-)-germacrene D synthase
     103493390
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Terpene_synth_C Terpene_synth
Motif
Other DBs
NCBI-GeneID: 103493390
NCBI-ProteinID: NP_001315388
UniProt: A0A0B4VEV4
Position
Un
AA seq 570 aa AA seqDB search
MSSQVSNFPTSIMKTNDIPDVKRSLAIFHPNIWKEHFLSFTFDDALKVDEGMKERTEKLK
EEIRMMMIAYVENQLVKLNLVDSIQRLGVSYHFEDEIDEFLKHIYVSYNNSLLLSNKDIE
GEDLHITALLFRLLRQQGYRISCDIFLKFMDDNGKFKESLVEDERGILSLYEASHMMVHG
EALLEEALEFTTTHLQTYVHRYSNINPSFASEVSNALKLPIRKGVPRMKAREYLEIYQQH
PSHNETLLTFSKLDFNALQKLHQKELAEICRWWKDLNVSTNFPFARDQIVECYFWILSIY
FEPRFKFGRKILTKVIAMTSIMDDIYDAYGTFEELQVFTLAIKRWDMSMINLLPKYMKVY
YTTLLDLFEEIDKEIVNDETSYRFHFAKEAMKRQAESYFKEAEWLNKNYKPKYEEYMEVA
LASSGYELLSTISFVCMGDIATKEIFDWLFDCPKILKASTTISRLMDDVVSYKFEKEREH
VVSAVECYMNNYGCSEEETCADLLKQVEDAWKTINKCCLHPMTVPIPFLICVLNLTRVMA
LLYSGEDGYTNSKGRTKLLIQSLLIDPLYM
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atgtcttctcaagtttcaaattttcctacttccattatgaaaaccaatgatattcctgat
gttaagcgttctcttgcaatttttcatcctaatatttggaaggaacatttcctttcattt
acatttgatgatgcattgaaagtagatgagggcatgaaagaaagaactgaaaagttgaaa
gaagaaataagaatgatgatgattgcttatgtggaaaatcaactggttaagttaaatttg
gttgattcaatccaacggctaggagtatcctatcattttgaagatgagattgatgaattc
ttaaaacatatatatgtgtcttataataattctcttttattgagtaacaaagatattgaa
ggtgaagatcttcatattactgctcttctatttcgacttctgaggcaacaaggttatagg
atttcatgtgatatatttttgaagttcatggacgacaatggaaaattcaaagagtcactg
gttgaggatgaaagaggaatattgagcctatatgaagcatcacatatgatggtacatgga
gaagctttgctcgaggaagctcttgaatttacaaccacacatcttcaaacatatgttcat
cgttactcaaatattaatccaagttttgcatctgaagttagtaatgcattgaaattgcct
attagaaaaggtgtcccaagaatgaaggcaagagagtacttggaaatttaccaacagcat
ccttctcacaacgagactttgcttacattctcaaaacttgacttcaacgccttacaaaag
cttcaccaaaaggagctagcggaaatctgcagatggtggaaggatttgaacgtttcaaca
aactttccatttgcgagagatcaaattgtggagtgttacttttggatattgagtatatat
tttgaacctcgtttcaagtttggaaggaaaatattaactaaagtgatcgctatgacctca
attatggatgatatatatgatgcatatgggacatttgaagagctccaagtttttacctta
gcaatcaaaagatgggacatgagcatgatcaatctactgccgaagtatatgaaagtttat
tatacaaccctgcttgatctttttgaagagattgataaagagatagtcaatgatgaaaca
tcctatcgctttcattttgcaaaagaagccatgaaaaggcaagctgaatcctatttcaaa
gaagctgaatggctaaacaaaaattataaaccaaaatatgaagaatacatggaagtggct
ttagctagttcaggttatgaactactttcaactatttcatttgtttgcatgggtgacatt
gcaacaaaggaaatatttgattggctttttgattgtcccaaaattcttaaagcctcaacc
actatttctagactcatggacgatgttgtctcctacaagtttgagaaagaaagagaacat
gttgtttctgcggttgaatgttacatgaacaattatgggtgctcagaagaagaaacatgt
gctgacttacttaagcaagtagaagacgcatggaagactataaataaatgttgccttcat
ccgatgactgttccaattccatttttaatttgtgtattaaatctcacaagagttatggct
ctactttattctggtgaagatggatatacaaattctaagggtaggactaaacttcttatt
cagtctctacttattgatccattgtatatgtaa

DBGET integrated database retrieval system