KEGG   Cucumis melo (muskmelon): 103495131Help
Entry
103495131         CDS       T03195                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1-like
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
cmo  Cucumis melo (muskmelon)
Pathway
cmo00010  Glycolysis / Gluconeogenesis
cmo00562  Inositol phosphate metabolism
cmo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cmo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    103495131
   00562 Inositol phosphate metabolism
    103495131
Enzymes [BR:cmo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     103495131
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     103495131
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 103495131
NCBI-ProteinID: XP_008454820
UniProt: A0A1S3C079
Position
Un
AA seq 504 aa AA seqDB search
MNDNKEEIKTVMPIILLIFFLFLFSNFRAEELTFDVRQHLSTVTRYDASKGGRNNNHTVP
PRPDGCVPIHLNLVARHGTRAPTKKRIEELNNLENELKKLLGDDVGIIDLSLHQVPSWLK
KWKSPWSEKVNGGELILEGEEELYDLGIRTKKLFPDLLSDDYHPNVYTIKATQIDRASAS
AVAFGMGLFNGSGSLGSDRHRAFSVVSESRANDTMLRFFECCRRYKKYKKKQKPEVEKLK
EPVLHDITKSLTKRYGLNFTQQHISSLWFLCKQEASLLNKTNQACGLFNPSEVALLEWTD
DIEVFMLKGYGNPLNYRMGVHLLKDVFESMKNAIKAKQDPGRLHEKARLRFSHAETVIPF
TCLLGLFREGEGFYKQIQKKQPLELPPRPPATRNWKVSNVSPFAGNNMLVLYSCPIANSS
DEYFVQVLHNEEPIAMPGCDGSYFCPFNIFKNKIVDPSLKHDFKKLCTLNEEQPTQVLES
SKLSLFNWFFWLFNDDKQPRKDEL
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgaatgacaacaaggaagaaattaaaactgtgatgccgattattcttctaatatttttc
ttattcctattctctaatttcagagccgaagagctaacgttcgacgtaaggcaacatctc
tccactgttaccaggtatgatgcatcgaaaggtggacgtaataataaccatactgttcct
cctcgtcctgatggatgtgttcccattcacttaaatcttgtggcaaggcatggaactcgt
gctccgaccaaaaaacggatcgaagagttaaacaacttggaaaatgaattaaagaagctc
ttaggagatgatgtaggaattattgacttgtctcttcaccaagttccttcttggttgaag
aaatggaaatctccttggagtgaaaaagtaaatggtggagaattaattcttgaaggagag
gaagaactgtatgatctcggaattcgaacaaaaaaattgtttcctgatttattgagtgat
gactatcaccccaacgtatatacaatcaaagcaactcagattgatcgagcatcggctagt
gctgtggcatttggtatggggctattcaatgggagtggaagccttggttcagatcgtcat
cgggctttctcggtcgttagtgagagtcgtgctaatgatacaatgctaaggttttttgaa
tgttgtcgaagatataagaaatacaaaaagaaacagaaacctgaagtggagaagcttaag
gaacctgtactccatgatataactaagtcactcacaaaacgttatggtctaaattttact
cagcaacacatttcatctctttggtttctttgtaagcaggaggcatccttattgaacaaa
acaaatcaagcttgtggattgttcaacccttccgaggttgctttgttggagtggacagac
gatatagaagtgtttatgttgaagggttatggcaatccattaaattatagaatgggagtt
catttattgaaagatgtttttgaatccatgaagaacgctatcaaagccaaacaagatcct
ggaaggcttcatgagaaggcaagacttcgtttctctcatgctgaaactgttattccattc
acatgtttgcttgggctcttccgtgaaggagaaggattctataaacaaatccaaaagaag
cagcctttagaacttcctcctcggcctccagctactagaaactggaaggtaagcaatgtt
tcaccttttgctgggaataacatgttggttctctatagctgtcctattgctaattcatct
gacgagtactttgttcaagtcttgcataatgaagagcccatagcaatgccgggttgtgat
gggtcgtacttttgccccttcaacatattcaagaataaaattgtggatccttctcttaag
catgatttcaagaagttgtgcactctaaacgaggaacaaccaacacaggtgcttgaatca
agtaagttatcattgttcaattggttcttctggcttttcaatgatgataaacaacctcga
aaagatgaattgtaa

DBGET integrated database retrieval system