KEGG   Cucumis melo (muskmelon): 103495967Help
Entry
103495967         CDS       T03195                                 

Definition
(RefSeq) arogenate dehydratase/prephenate dehydratase 1, chloroplastic-like
  KO
K05359  arogenate/prephenate dehydratase [EC:4.2.1.91 4.2.1.51]
Organism
cmo  Cucumis melo (muskmelon)
Pathway
cmo00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cmo01100  Metabolic pathways
cmo01110  Biosynthesis of secondary metabolites
cmo01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cmo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    103495967
Enzymes [BR:cmo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.51  prephenate dehydratase
     103495967
    4.2.1.91  arogenate dehydratase
     103495967
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PDT ACT
Motif
Other DBs
NCBI-GeneID: 103495967
NCBI-ProteinID: XP_008455888
UniProt: A0A1S3C1J0
Position
Un
AA seq 389 aa AA seqDB search
MMNLPSAMALGDSSSLWCLVPKLTQSPVSLKLEFRGGILGLPASSMTCSIEAEKPPNRTT
ELQPVNDQADGSIVRKLNKDMASFHKPLSVSNVSAYPNDDKKVRISFKGLPGSYSEDAAL
KAYPNCESVPCNEFEDAFKAVELWMADKAVLPIENSSGGSIHRNYDLLLRHRLHIVGEVQ
LATNLCLLALPGVRAEQLKRVLSHPQALALSDTVLNRLGVVRENVDDTAGAAQYVASSNL
RDAGVVAGARTAELYGLNILAEGIQDDLSNVTRYLVLTREPIIPRTDRPYRTSIVFTLDE
GAGVLFKVLALFALREINLTKIESRPQRNRPLRVVDDSNMGTAKYFDYLFYIDFEASMAE
PRAQHALGLLQEHATFLRVLGCYPMDVAS
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgatgaatttaccgagtgctatggcgttgggtgattcctcttctttgtggtgtttggtg
cctaagttgacgcagtctcctgtctcgttgaaattggaattcagaggagggattttagga
ttgccggcttcctcaatgacttgctctattgaggctgagaagccgccgaatcgaaccacg
gagttgcagccagttaacgatcaggcggatgggagtattgttcggaaattgaacaaggat
atggcctcttttcataaaccattatctgtgtcaaatgtatcagcttatccgaatgatgat
aaaaaggttcgaatatcatttaaggggttgccaggttcatacagtgaagatgcagcactt
aaagcataccctaattgcgaaagtgttccttgtaatgagtttgaagatgcatttaaggct
gttgaattatggatggctgataaagctgttcttccaattgagaactcatcaggtgggagc
atccatcgcaactatgatttgcttcttcgacacaggctacatattgttggtgaagtgcag
ttagccaccaatttgtgccttctagctcttcctggtgtgagagcagaacagttgaaacgt
gttcttagccatccgcaggcacttgccttgagtgatactgtcttgaataggttgggtgtt
gtccgagaaaatgtagatgatacagccggtgctgctcagtatgtagcatcgagtaacctc
agggatgctggagttgttgcaggtgctcgaactgcagaattgtatggtttaaacatactt
gcagaaggaatccaggatgatttaagtaatgtgactcgttatctggtacttacaagggaa
ccaatcattccaagaactgataggccctatagaacaagcattgtgtttactttggatgaa
ggggctggagtcttgttcaaagtcttggcgttgtttgcactaagagagattaatttgaca
aagattgaaagtcgaccacaaagaaatcgccctttacgagtagtggatgactctaacatg
ggtactgctaagtactttgactacttgttctatattgattttgaagcttctatggccgaa
ccacgtgcgcagcatgccttggggcttttgcaggaacatgcaacgtttcttcgggtactt
ggttgctatccaatggacgtggctagctag

DBGET integrated database retrieval system