KEGG   Cucumis melo (muskmelon): 103496583Help
Entry
103496583         CDS       T03195                                 

Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase CYP28, chloroplastic
  KO
K03768  peptidyl-prolyl cis-trans isomerase B (cyclophilin B) [EC:5.2.1.8]
Organism
cmo  Cucumis melo (muskmelon)
Brite
KEGG Orthology (KO) [BR:cmo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:cmo03110]
    103496583
Enzymes [BR:cmo01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     103496583
Chaperones and folding catalysts [BR:cmo03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    103496583
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_isomerase
Motif
Other DBs
NCBI-GeneID: 103496583
NCBI-ProteinID: XP_008456727
UniProt: A0A1S3C403
Position
Un
AA seq 310 aa AA seqDB search
MAFALLSTYSSSAAAITTALLPPHHNYRRFRSGDTTLPRRSLLLLSTSLSLSTAINPPPS
PASPSPDTTITDRVFIDFSICPTNFLPNRESTDDGSDSLLCSDSVLLGRLVIGLYGHLVP
ITVSNFKSMCTGSCGSSYKGTLVHKIFPGQFFLAGRQGRRDKGEVRPPLQLPRNTESVKS
DSFLLSHSRGGVVSLCLSENDDDDDLKLDPDYHNVEFLITTGPGPCPQLDSKNIVFGTVL
EGLDVVAAISSTPTYKPSERIRQFNDLAKFLGDERAQNARTIWNRPLQTVYISGCGELKV
AKPSLSPTLP
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atggccttcgctctcctttccacctactcctcctccgccgccgccattaccactgccctc
ttacctccacatcacaactatcgccgtttccgctccggagacaccacactccctcgccgc
tctctcctccttctctccacgtccctctctctctccaccgccatcaatcctcctccctcc
ccggcttctccatctccagacaccaccatcactgaccgcgtcttcatcgacttcagcatt
tgccctaccaacttcctccctaaccgtgaatccaccgatgatggtagcgattccctcctc
tgctctgattccgtcctacttggccgcctcgtgattggcctctacggccatctcgttcct
atcaccgtctctaatttcaaatccatgtgtaccggatcctgcggctcctcgtataaaggc
actttggttcacaaaatcttccctggccaattcttccttgctggccgacagggacgccgt
gacaaaggagaagttcggccgccgttgcaattgccgagaaatacggaatcggtgaagtca
gattcgttcttgctttcgcattcgagaggcggcgttgtttctctttgcctttcggagaac
gatgacgatgacgatttgaagttggatccggattatcataatgtggaattcttaatcaca
accggccctggcccctgccctcagcttgacagcaagaacattgtcttcgggactgttctt
gaaggactggatgttgtggcagccatatcctcaactccaacatataagccatctgagaga
attaggcaattcaatgatttggctaagtttttaggagatgaaagagctcaaaatgcaaga
acaatatggaacagacctctccaaactgtttacatcagtggctgtggagagctcaaagtt
gcaaagccttcactatctccaactctgccttaa

DBGET integrated database retrieval system