KEGG   Cucumis melo (muskmelon): 103497844Help
Entry
103497844         CDS       T03195                                 

Definition
(RefSeq) UDP-glucuronic acid decarboxylase 2-like
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
cmo  Cucumis melo (muskmelon)
Pathway
cmo00520  Amino sugar and nucleotide sugar metabolism
cmo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cmo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    103497844
Enzymes [BR:cmo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     103497844
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase 3Beta_HSD RmlD_sub_bind NAD_binding_4 Polysacc_synt_2 adh_short KR
Motif
Other DBs
NCBI-GeneID: 103497844
NCBI-ProteinID: XP_008458422
UniProt: A0A1S3C7Y3
Position
Un
AA seq 448 aa AA seqDB search
MNNSDLLRRNQSNPSPAVIDSPRTPPCSSCKTRSPIRYMLREQRLLFVFVGIAIATLFFN
VVRFTFPPELRDDHHRALNSFVRLGSTIPMRRVLYETRREGSLGRVNLAGRVPPGLKNKN
LRIVVTGGAGFVGSHLVDRLIERGDSVIVVDNFFTGRKDNLVHHFGNPRFELIRHDVVQP
ILLEVDQIYHLACPASPVHYKFNPVKTIKTNVVGTLNMLGLAKRVGARFLLTSTSEVYGD
PLQHPQAETYWGNVNPIGVRSCYDEGKRTAETLTMDYHRGLGIEVRIARIFNTYGPRMCI
DDGRVVSNFVAQALRKEPLTVYGDGKQTRSFQYVSDLVEGLMKLMEGEHVGPFNLGNPGE
FTMLELAQVVQETIDPNARIEFRPNTEDDPHKRKPDISKAKDLLGWEPTVSLRKGLPLMV
SDFRQRIFGDSKDDITAADALVTTTTTV
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgaataattctgaccttcttcgaagaaatcaatccaatccgtccccggcggtgatcgat
tcaccacgaactccgccatgttcttcctgcaaaaccaggagcccgatccgttacatgctt
cgtgagcaacgtcttctctttgtttttgttgggattgccattgcaactctgttttttaat
gtcgttcgtttcacttttccgccggagttacgtgatgatcatcaccgggcgttgaattcg
tttgttcgattgggttcgacgatcccgatgcggagagttttgtatgaaactcgccgtgaa
ggatcgttggggcgggtgaacttggcggggagagttccgccgggattgaagaataagaac
ttgaggattgttgttactggtggtgctggattcgttggaagccatcttgtggaccgtttg
attgagagaggggatagcgtgatcgttgttgataatttcttcactggacggaaggataat
ctggttcatcattttggaaatccgagatttgaactgattcgacacgacgttgttcagccg
attctactggaagttgatcagatctatcacttggcttgccctgcttctcctgttcattat
aagttcaatcctgtcaagacaatcaagaccaacgttgtcggcacattgaacatgctaggg
cttgcgaagagagtcggcgcccgcttcttactcaccagcaccagcgaagtctacggcgat
ccactccaacacccgcaggctgaaacctactggggcaacgtcaatcccatcggtgtacga
agctgctacgacgaaggaaagcggacggcggagactttgacaatggattaccacagaggc
cttggcattgaggtgcggattgctcggatcttcaacacttatggaccacggatgtgcatt
gatgacggccgagttgtgagcaatttcgtagcacaggcattaagaaaggagccgttgaca
gtttatggagatggcaagcaaacccggagttttcaatacgtttccgatctggtggagggg
ctaatgaaactgatggaaggtgagcacgtgggcccttttaatctgggcaaccccggcgaa
ttcactatgctcgaacttgcccaggtagtacaagagacaatagatccaaatgcaagaata
gagttcagaccaaacacagaagacgacccacataaaagaaagcccgacatttctaaagct
aaggaccttcttggttgggagcccaccgtgtcccttcgaaagggcctcccccttatggtt
tccgattttcgtcaacgcatctttggtgactcgaaagatgacattaccgcggccgatgcc
ctcgtcaccaccaccaccacggtctag

DBGET integrated database retrieval system