KEGG   Cucumis melo (muskmelon): 103497998Help
Entry
103497998         CDS       T03195                                 

Definition
(RefSeq) protein phosphatase 1 regulatory subunit pprA
  KO
K17550  protein phosphatase 1 regulatory subunit 7
Organism
cmo  Cucumis melo (muskmelon)
Brite
KEGG Orthology (KO) [BR:cmo00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cmo01009]
    103497998
Protein phosphatases and associated proteins [BR:cmo01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     103497998
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_4 LRR_8 LRR_9
Motif
Other DBs
NCBI-GeneID: 103497998
NCBI-ProteinID: XP_008458673
UniProt: A0A1S3C7Y5
Position
Un
AA seq 333 aa AA seqDB search
MAAVSEPSPVSESKEDDLNSTVLDLTSYQLHDLDSIELPSSLTELDLTANRLTNLDPRIG
ELSNLKKLSLRQNLINNAAVESLSRWNALSGLEELILRDNQMTKIPDASIFKRLLVFDVS
FNEITSLHGLSTVSNTLKELYVSKNEVSKMEELDHFLQLQILELGSNRLRVMENMENLTN
LQELWLGRNRIKAVNLCGLKCLKKISLQSNRLTSMTGFEDCVALEELYLSHNGISKIEGV
STLVNLRILDVSSNKLTSVSDIQNLTCLEDLWLNDNQIESLETIAEDVAGSREKLTTIYL
ENNPCAKTSNYSARLREIFPNIQQIDSEIFTKL
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atggccgccgtaagcgaaccatcgccggtttcggaatcgaaggaggatgatcttaattct
acggttcttgatctcaccagctatcagctccatgacctcgactctatcgagttgccttcg
agtttaacggaattggacctgactgcgaatcgacttacgaatttggaccctcggattgga
gagctctcgaacctgaagaagctctctcttcgtcagaatctcatcaataatgctgctgtt
gaatcgctatctcgctggaacgcactgtcaggtctcgaggaacttattctcagagacaat
caaatgacgaagatacctgatgcgagcatattcaagaggcttttggtatttgatgtttct
ttcaacgaaatcacttcgttacatggcttgtcgacggtctccaatacactgaaggaactt
tatgtatcaaagaatgaagttagtaaaatggaagagctagatcacttccttcagttgcag
attcttgagcttggttccaatagactgcgggtaatggagaatatggaaaacttaaccaat
ttacaagagctatggttagggcgtaaccgaattaaggcagtaaacctttgtggactgaaa
tgtctcaagaaaattagtttgcaaagcaaccgtttgacttcaatgacaggatttgaggac
tgtgttgctttggaagaactgtatctaagccataatggaatttcaaaaattgaaggtgtt
tcaaccttagtcaatctacggatattggatgtctcatcaaataagctaacgagtgtgagt
gacattcaaaatctgacatgtttagaagatttatggcttaacgacaaccaaattgaatca
cttgaaacgatcgctgaggatgttgctggttcgagggaaaaactgacaaccatatacctt
gagaacaatccatgtgcgaagacttcaaattatagtgccagactaagagagatctttccg
aacatacagcaaattgattcagagatctttacgaaattatga

DBGET integrated database retrieval system