KEGG   Cucumis melo (muskmelon): 103498164Help
Entry
103498164         CDS       T03195                                 

Definition
(RefSeq) heat shock cognate 70 kDa protein
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
cmo  Cucumis melo (muskmelon)
Pathway
cmo03040  Spliceosome
cmo04141  Protein processing in endoplasmic reticulum
cmo04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:cmo00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    103498164
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    103498164
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    103498164
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cmo01009]
    103498164
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:cmo03041]
    103498164
   03009 Ribosome biogenesis [BR:cmo03009]
    103498164
   03110 Chaperones and folding catalysts [BR:cmo03110]
    103498164
   04131 Membrane trafficking [BR:cmo04131]
    103498164
   03051 Proteasome [BR:cmo03051]
    103498164
   03029 Mitochondrial biogenesis [BR:cmo03029]
    103498164
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cmo04147]
    103498164
Protein phosphatases and associated proteins [BR:cmo01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     103498164
Spliceosome [BR:cmo03041]
 Complex B
  Other components
   Prp19 complex
    103498164
 Complex C
   Prp19-CDC5 complex
    103498164
Ribosome biogenesis [BR:cmo03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    103498164
Chaperones and folding catalysts [BR:cmo03110]
 Heat shock proteins
  HSP70 / DNAK
   103498164
Membrane trafficking [BR:cmo04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    103498164
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    103498164
Proteasome [BR:cmo03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    103498164
Mitochondrial biogenesis [BR:cmo03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    103498164
Exosome [BR:cmo04147]
 Exosomal proteins
  Proteins found in most exosomes
   103498164
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C Hydantoinase_A
Motif
Other DBs
NCBI-GeneID: 103498164
NCBI-ProteinID: XP_008458892
UniProt: A0A1S3C8G2
Position
Un
AA seq 648 aa AA seqDB search
MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKN
QVAMNPLNTVFDAKRLIGRRFSDPSVQSDMKLWPFKVIAGPGDKPMIVVNYKGEEKQFAA
EEISSMVLTKMREIAEAYLGSSVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD
NRLVNHFVQEFKRKHKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGIDFY
TTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSSVHDVVLVGGSTRIPKVQQLLQDFF
NGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLI
PRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTKDNNLLGKFELSGIPPAPRGVPQI
TVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKLVQEAEKFKAEDEEHKK
KVESKNALENYAYNMRNTIRDEKISGKLAPADKKKIEDAVEQAIQWLDSNQLAESDEFED
KMKELESICNPIIAKMYQGGADMGSAAMNDDAPPSGGSGAGPKIEEVD
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atggcgggaaagggagaaggtccggccatcggtatcgatctcggtaccacttactcttgt
gttggagtttggcaacatgatcgtgttgagattattgctaatgatcaaggtaatcggacc
acgccctcctatgtcgcgttcactgatactgaacgactcatcggtgacgctgccaagaac
caagtcgctatgaatcctctcaacaccgtctttgatgcgaagcgtttgattggaaggaga
ttctccgatccttcggttcagagcgatatgaaattatggccattcaaggtgatcgccggt
ccaggggacaagcctatgatcgtcgtcaattacaaaggcgaagagaagcaatttgcagct
gaggaaatctcatccatggttcttacaaaaatgcgtgagattgcagaagcttaccttggt
tcctccgtgaagaacgccgtcgtcaccgttcctgcttacttcaatgactctcaacgtcaa
gccaccaaggacgccggagtcatcgccggtcttaatgttatgcgtatcatcaacgagcct
acagctgcagccattgcttatggactcgacaaaaaggcgaccagcgttggcgagaagaat
gttctgattttcgatctgggtggaggaacatttgatgtctctctcctcacaatcgaggaa
ggaattttcgaggtgaaggcaaccgccggtgacacccatcttggcggtgaggatttcgac
aacagattagttaaccatttcgttcaggaattcaagaggaagcataagaaagacatcagt
ggaaatccaagggctctcaggagattgagaactgcttgtgaaagagccaagagaaccctt
tcatctactgcccaaacaacaatcgaaatcgattctctgtacgaaggaatcgatttctac
acaacaattactcgcgctagattcgaagaactcaacatggatctcttccgaaagtgtatg
gagccagttgagaaatgtttgagagatgcaaagatggacaaaagctccgtccatgatgtt
gttcttgtaggtggttctacaagaattccaaaggtacaacagctattgcaagatttcttc
aatggcaaggagctttgcaagagtatcaaccctgatgaggctgttgcttatggagctgct
gttcaagccgccatcttgagtggtgaaggaaacgagaaagtgcaagaccttcttcttttg
gatgttactcctctatcccttggtttagaaactgcaggaggtgtaatgacagttttgatt
ccgaggaacacgacgatcccgacaaagaaggagcaagttttctctacttactcagacaac
caacctggtgttcttattcaagtctacgaaggagaaagaacaagaacaaaagacaacaac
ttgttgggtaagtttgaactttcaggaattcctccagctcctagaggtgttcctcaaatc
actgtttgcttcgacatcgacgcaaacggtatccttaatgtatcggccgaggataaaacc
accggacaaaagaacaagatcacgattaccaacgacaaagggaggttatcgaaagaagag
attgagaaattggttcaagaagcagagaaattcaaggcagaggacgaagaacacaagaag
aaagtcgaatccaagaatgctttagaaaactatgcttacaatatgaggaacacaatcaga
gatgaaaagattagcggtaagcttgctccggctgataagaagaagattgaagatgcagtt
gaacaagcaattcagtggctagatagcaatcagctggctgaatcagatgaatttgaagac
aagatgaaggaacttgagtcaatttgcaaccccatcatagccaagatgtatcagggcggt
gccgatatgggcagcgctgccatgaacgatgatgctcctccttctggtggcagtggcgct
ggtcctaagattgaagaagtcgattaa

DBGET integrated database retrieval system